'F0' P/hn<FȕE%dont smoke fish, drink bud. decompiler_error0123456789abcdefhex16 () hex32AddIntSubIntNegInt fnstringstrcpyBig Endian architecture detected Little Endian architecture detected Alignment detected No alignment detected InternalInit0000000000000001InitSearchHunkGetHunkName--- HUNK --- context x : edictsPrintHunkXXXXXXXXfound iplogzoneFound start of hunk in frames SearchHunkxxxnet_hide_ip connected from net_connectstring_length(): string too big string_lengthstrlen(): string too big strlenallocate_hunkallocate_string_size(): bytes < 1 or bytes > 255 allocate_string_sizeallocate_stringstrcatsubstr(): expr < 1 or expr > 255 substrsubstr_replace(): expr < 1 or expr > 255 substr_replaceflenhex_ctofdec_ctofatocatofeval_exponentstof_anystofGet_HunkRead_Hunk_Vector: hunk is null Read_Hunk_VectorRead_Hunk_Float: hunk is null Read_Hunk_FloatRead_Hunk_String_e: hunk is null Read_Hunk_String_eRead_Hunk_StringRead_Hunk_String_Max_e: hunk is null Read_Hunk_String_Max_e: bytes is too large Read_Hunk_String_Max_eRead_Hunk_String_MaxRead_Hunk_String_Exact_e: hunk is null Read_Hunk_String_Exact_e: bytes is too large Read_Hunk_String_Exact_eRead_Hunk_String_ExactWrite_Hunk_Vector: hunk is null Write_Hunk_VectorWrite_Hunk_Float: hunk is null Write_Hunk_FloatWrite_Hunk_String_e: hunk is null Write_Hunk_String_eWrite_Hunk_StringWrite_Hunk_String_Max: hunk is null Write_Hunk_String_MaxWrite_Hunk_String_Exact_E(): hunk is null Write_Hunk_String_Exact_E(): bytes < 1 Write_Hunk_String_Exact_EWrite_Hunk_String_Exact_e(): hunk is null Write_Hunk_String_Exact_eWrite_Hunk_String_Exactserver_timeupdate_server_time0000:00:00:parse_time with proquake version 0.00 with a non-proquake client with an unknown proquake client as a qsmack client with a Qrack client.PQ_Versionarray_set_user_maparray_get_user_maparray_set_kickarray_get_kickarray_set_passwordarray_get_password 5 st!g000 qt!g1000 qt!g2000 qt!g3000 qt!g4000 qt!g5 lt!g0 lt!g1 lt!g2 lt!g3 lt!g4 lt!g5 lt!g6 lt!g7 lt!g8 lt!g9 3 nt!g mt!g11 mt!g21 mt!g31 mt!g41 mt!g51 mt!g12 mt!g22 mt!g32 mt!g42 mt!g52 mt!g13 mt!g23 mt!g33 mt!g43 mt!g53 mt!g14 mt!g24 mt!g34 mt!g44 mt!g54 mt!g15 mt!g25 mt!g35 mt!g45 mt!g55 mt!g16 mt!g26 mt!g36 mt!g46 mt!g56userdefs_init_world1 2 3 4 5 6 7 8 9 101112131415202530???strings_ftos?strings_ftos_goldstrings_ftos_bronzeNone 5 10 20 30 40 50 60 70 80 90 100110120130140150160170180190200strings_get_armour_val R Y G strings_get_armor_type123456789354050556065707580859095105115125135155165175185195205210215220225230235240250strings_get_armor_val R Y G strings_get_armour_type Q Rocket Launcher Q Lightning Gun Q Grenade Launcher Q Super Nailgun Q Super Shotgun Q Nailgun Q Shotgun Q Axe Q Hook Q No Weapon Q Rocket Launcher Q Lightning Gun Q Grenade Launcher Q Super Nailgun Q Super Shotgun Q Nailgun Q Shotgun Q Axe Q Hook Q No Weapon Rocket Launcher Lightning Gun Grenade Launcher Super Nailgun Super Shotgun Nailgun Shotgun Axe Hook No Weapon Rocket Launcher Lightning Gun Grenade Launcher Super Nailgun Super Shotgun Nailgun Shotgun Axe Hook No Weapon Q Rocket Launcher Q Lightning Gun Q Grenade Launcher Q Super Nailgun Q Super Shotgun Q Nailgun Q Shotgun Q Axe Q Hook Q No Weapon Q Rocket Launcher Q Lightning Gun Q Grenade Launcher Q Super Nailgun Q Super Shotgun Q Nailgun Q Shotgun Q Axe Q Hook Q No Weapon Rocket Launcher Lightning Gun Grenade Launcher Super Nailgun Super Shotgun Nailgun Shotgun Axe Hook No Weapon Rocket Launcher Lightning Gun Grenade Launcher Super Nailgun Super Shotgun Nailgun Shotgun Axe Hook No Weapon strings_get_weapon 0 5 10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100 105 110 115 120 125 130 135 140 145 150 155 160 165 170 175 180 185 190 195 200 205 210 215 220 225 230 235 240 245 250 666 strings_get_health_ammoBrown teamLight Blue teamGreen teamRed teamOlive teamGold teamFlesh teamLavender teamPurple teamBeige teamAqua teamYellow teamBlue team???? teamstrings_get_teamname strings_get_teamname_bronzeBrown Light BlueGreen Red Olive Gold Flesh Lavender Purple Beige Aqua Yellow Blue ???? strings_get_teamname2Brown Lt. BlueGreen Red Olive Gold Flesh LavenderPurple Beige Aqua Yellow Blue ???? strings_get_teamname3brownlight bluegreenredolivegoldfleshlavenderpurplebeigeaquayellowbluestrings_get_colour Brown up by Light Blue up by Green up by Red up by Olive up by Gold up by Flesh up by Lavender up by Purple up by Beige up by Aqua up by Yellow up by Blue up by ???? up by strings_get_teamname_up_bye1m1e1m2e1m3e1m4e1m5e1m6e1m7e1m8e2m1e2m2e2m3e2m4e2m5e2m6e2m7e3m1e3m2e3m3e3m4e3m5e3m6e3m7e4m1e4m2e4m3e4m4e4m5e4m6e4m7e4m8dm1dm2dm3dm4dm5dm6startendctf1ctf2ctf3ctf4ctf5ctf6ctf7ctf8ctf2m1ctf2m2ctf2m3ctf2m4ctf2m5ctf2m6ctf2m7ctf2m8ctf3m1ctf3m2ctf3m3ctf3m4ctf3m5ctf3m6ctf3m7ctf3m8ctf3m9ctf1bsp1ctf1bsp2ctf1bsp3ctf1bsp4ctf1bsp5ctf1bsp6ctf1bsp7ctf1bsp8ctf1bsp9ctf1bsp0ctfgold1ctfgold2ctfgold3ctfgold4ctfgold5ctfgold6ctfgold7ctfgold8strings_get_mapnameFFAClassicPracticeMatchDeathmatchstrings_get_mode/bFFA/bClassicstrings_get_mode_goldsstrings_szplural strings_get_rune_typelocalcmd2localcmd3localcmd4localcmd5localcmd6localcmd7echo cprintcprint2cprint3cprint4cprint5cprint6cprint7cprint8"" announceannounce2announce3announce4announce5announce6playeroprint2oprint3oprint4oprint5oprint6setcolorupdatenameclear_nameready_name afk_namedead_namechangelevel: still checking levels.cfg changelevel e4m3 changelevel changelevelutils_sprint_timeutils_sprint_stat_timeutils_cprint_int2utils_cprint_timeutils_dprint_timeutils_bprint_timeutils_bprint_floatutils_print_floatutils_print_floatn-99 utils_print_int3utils_print_int3_goldget_top_colorutils_print_damage_goldutils_cprint_damageutils_cprint_int3utils_print_vecutils_print_bit0 utils_print_binorigin = mins = maxs = size = absmin = absmax = utils_dump_positionutils_minutils_maxutils_min3utils_max3scheduled_event_entityutils_make_scheduled_eventutils_set_cvarutils_do_itemitem_healthitem_armor1item_armor2item_armorInvitem_shellsitem_spikesitem_rocketsitem_cellsweapon_nailgunweapon_supernailgunweapon_supershotgunweapon_rocketlauncherweapon_grenadelauncherweapon_lightningitem_sigilitem_artifact_invulnerabilityitem_artifact_envirosuititem_artifact_invisibilityitem_artifact_super_damageutils_do_itemsmissilegrenadespikeutils_do_projectileshook_chain_linkhook_entityutils_do_hookitem_flag_team1item_flag_team2utils_do_flagsutils_do_playersv_kickpitchutils_stofutils_visibleutils_new_visible disabled enabled utils_toggle_oflagutils_toggle_flag disabled enabledsamelevelutils_toggle_sflagutils_stuff_to_playerutils_get_bitutils_find_zerounconnected utils_illegal_namefind_team_entitysqrtRvecWriteBytePQWriteShortPQpqc_erase_teampqc_team_fragspqc_new_teampqc_match_timepqc_match_resetclient_pingbodyquepqc_ping_times ClanRing ClanRing NetQuake Server original works by by J.P. Grossman & Dave 'Zoid' Kirsch motd_init_worldmotd_thinkmotd_createBan hunk cleared. ;exec ban.cfg; clear_ban_hunkunmute_playerabc ip_to_vecban_check .xxx ban_listip doesn't exist ban 255.255.255.255 ip succesfully removed ban_removeinvalid ip address Address already banned. Banned Address Added: Ban ERROR. ban_saveipBan ERROR, invalid syntax. set_banipbuild_banipauto_compute_scoreauto_camera_thinkclanring_cameraauto_check_current_cameraauto_schedule_camerasauto_camera_startauto_chase_startauto_chaseauto_cameraclients: cameras: debug_infoServer flags: CLANRING_NORMAL_MODE CLANRING_MATCH_MODE CLANRING_PRACTICE_MODE CLANRING_SERVER_INITIALIZED CLANRING_NO_GIBS CLANRING_LOW_GIBS CLANRING_NO_QUAD CLANRING_NO_PENT CLANRING_NO_RING CLANRING_MODE_VOTE CLANRING_NO_SPOOGE CLANRING_EXTENDED_OBITS CLANRING_CONSOLE_INITIALIZED CLANRING_FAST_START CLANRING_AUTO_PAUSE CLANRING_AUTOSTATS CLANRING_TIMER_STARTED CLANRING_MATCH_STARTED CLANRING_MATCH_PAUSED CLANRING_MATCH_OVER CLANRING_MATCH_WAIT CLANRING_KICKING CLANRING_NO_PRACTICE CLANRING_UNPAUSING CLANRING_AUTO_PAUSED CLANRING_DELAYED_AUTOSS CLANRING_TAKING_AUTOSS debug_flagsclanring_num_spawns = clanring_num_starts = clanring_num_cameras = clanring_score_count = clanring_numteams = clanring_sentinel.ammo_rockets = debug_vars = name crctfdebug debug_cvar_thinkauto_parm1 changed from to debug_parm1_thinkauto_parm2 changed from debug_parm2_thinkauto_parm3 changed from debug_parm3_thinkauto_parm4 changed from debug_parm4_thinkauto_parm1 = auto_parm2 = auto_parm3 = auto_parm4 = debug_parmsClient flags for : CLANRING_NEW_CLIENT CLANRING_ADMINISTRATOR OBSERVER_POP_FORWARD CLANRING_READY CLANRING_YES CLANRING_HEADS_UP CLANRING_SETTING_OPTIONS CLANRING_MOTD CLANRING_OK_TO_SHOOT CLANRING_KICK_CONFIRM CLANRING_CONFIRM_LEAVE CLANRING_CONNECTED CLANRING_FOUND_BINDINGS CLANRING_SMART_WEAPON CLANRING_OBSERVER CLANRING_SCOREBOARD CLANRING_NO_POST_THINK CLANRING_WINQUAKE CLANRING_GLQUAKE OBSERVER_WALK OBSERVER_FLY OBSERVER_CHASE OBSERVER_DEMO OBSERVER_CAMERA OBSERVER_AUTO OBSERVER_TOURNEY OBSERVER_GO_AUTO OBSERVER_COMMENTARY CLANRING_BLUE_TEAM CLANRING_RED_TEAM debug_client_flagsDebugging Not found debug_get_movetargetDebug commands: dbinfo - General info dbflags - Server flags dbvars - Elohim global variables dbcvar - Console variable dbclient - Choose movetarget dbcflags - View movetarget flags dbparm1-4 - change auto_parm1-4 dbparms - view auto_parms dbplayers - list players dbteams - list teams dbsettings - list server settings dbents - show entity information dbwingl - who is using dos/win/gl debug_helpdebug_playersValid in match mode only - rockets = debug_teamson off debug_onoffdebug_show_cvar mode timelimitfraglimitteamplaydeathmatchpausablesys_ticratesys_ticrate = overtime: sudden death disabled minutemaxteams: gibs: low high safe practice: quad: pentagram: ring: mode voting: extended obituaries: fast match starts: debug_settings 0 " "debug_entities ??? WinQuake GlQuake DosQuake debug_winglLoading debug binds... alias dbbinds echo debug binds already loaded alias dbinfo impulse 40 alias dbflags impulse 41 alias dbvars impulse 42 alias dbcvar impulse 43 alias dbclient impulse 44 alias dbcflags impulse 45 alias dbparm1 impulse 46 alias dbparm2 impulse 47 alias dbparm3 impulse 48 alias dbparm4 impulse 49 alias dbparms impulse 50 alias dbplayers impulse 51 alias dbteams impulse 52 alias dbsettings impulse 53 alias dbents impulse 54 alias dbwingl impulse 55 alias dbhelp impulse 59 debug_load_aliasescrctfdebugEnter client number: debug_impulsequaketag_init_world䡡 Quake Tag Activated! is itdemon/sight2.wavdog/dsight.wavknight/ksight.wavogre/ogwake.wavshambler/ssight.wavsoldier/sight1.wavPreach on, brother! You got that right! BIG TIME!!! You listening Zoid!? quaketag_init򡠠ٯΩ "Quake Tag Over!" quaketag_clearquaketag_disconnect_notifyquaketag_respawnquaketag_start_frame 1 Doomed Dimension 報 2 Realm of Black Magic 堲 3 Netherworld 堳 4 Elder World 場 5 id Deathmatch Arenas 6 Threewave CTF Levels Pak 1 7 Threewave CTF Levels Pak 2 8 League Of Capture 9 ThunderWalker Pak 10 CTF Gold Pak 11 Custom Maps select map category warp_menu_top  Slipgate Complex  Castle of the Damned  Necropolis  Grisly Grotto  Gloom Keep  Door To Chthon  House of Chthon  Ziggurat Vertigo select map warp_menu_one  Installation  Ogre Citadel  Crypt of Decay  Ebon Fortress  Wizard's Manse  Dismal Oubliette  Underearth warp_menu_two  Termination Central  Vaults of Zin  Tomb of Terror  Satan's Dark Delight  Wind Tunnels  Chambers of Torment  Haunted Halls warp_menu_three  Sewage System  Tower of Despair  Elder God Shrine  Palace of Hate  Hell's Atrium  Pain Maze  Azure Agony  Nameless City warp_menu_four  Place of Two Deaths  Claustrophobopolis  Abandoned Base  Bad Place  Cistern  Dark Zone Start warp_menu_five McKinley Base The Kiln DySpHoRiA The Forgotten Mines Da Ancient War Grounds Vertigo Dale Tale of Two Cities The StrongBox warp_menu_six McKinley Station The Warzone Spill the Blood Ruins of NeoMinonk Disciple War Grounds The Two Towers Gloom Castles Capturephobolis warp_menu_seven Remix Red Alert Stop the Flow Nameless Mines Egyptian Pig Factory Terra Firma The Dark Age The Place of Two Bases The CHEAT Complex 2: warp_menu_eight Holy Warz Tormented Fortress The BanZoia Barbie's Domain [CapturE CastleS] Tickle-Me Shambler? Never Mined The Forgotten Outpost Salvage The Weak Capturellamaphobopolis warp_menu_nine The Mess Hall Badical Bunkers Arax Installaflagus Elder Quad Shrine The Capture Zone Flags n' Frags Abandoned Dungeon warp_menu_tenselect map warp_menu_eleven select_mapcanceled select_episodeWait for map to initialize Cannot change level while match is in progress. client_select_warpangles_pick_angleangles_bestaimangles_fixangleChase_cam_setweaponchase_camprogs/eyes.mdlStart_chase_camReable_chase_camRemove_chase_camKeep_cam_chasing_ownerToggle_chase_camChase_cam_lvlstart_thinkChase_cam_level_startclear_afk_status was kicked!kick # was kicked for being afk. lost connection to the server.Error Kick Called without kick_mode set clanring_kick_playerClanRing Mod v3.6ClanRing Mod v3.6 1/27/2014 1:45PM3.6CLANRING_Sentinelwizard/wsight.wavdoors/drclos4.wavv_kickrollv_kicktimev_iyaw_cycleclanring_init_world"Searching for optional configuration file .cfg" "It is OPTIONAL - there is nothing wrong if it can't be found." ;exec .cfg; ;wait clanring_map_configtrigger_teleport"start: bad teleport removed (this is not an error)" clanring_remove_start_teleportclanring_find_powerups"Searching for optional file entities/.ent" ;exec entities/.ent; ;wait clanring_ent_config"Searching for optional file cameras/.cam" ;exec cameras/.cam; ;wait; clanring_cam_confignoexitLoading Main Configuration File ;exec crctf.cfg; ;wait; ;[done]; sv_aim 2;wait -done- clanring_exec_configsteamplay "?CRCTF vclanring_set_teamplayfraglimit " : CRCTF : CRMod Match" Deathmatch" : ClanRing Practice" Classic" clanring_set_fraglimitSending bindings alias chase_active impulse 24 alias r_ambient echo r_ambient has been disabled on this server. ambient_level 0 alias dbbinds impulse 58 alias help-server impulse 100 alias helpserver impulse 100 alias help-observer impulse 101 alias rules impulse 103 alias teamplay impulse 103 alias deathmatch impulse 103 alias timelimit impulse 103 alias fraglimit impulse 103 alias noexit impulse 103 alias help-misc impulse 105 alias commands impulse 106 alias levels impulse 102 alias warp impulse 107 alias admin impulse 108 alias motd impulse 109 alias admins impulse 110 alias autoweapon impulse 114 alias aw impulse 114 alias yes impulse 115 alias no impulse 116 alias vinfo impulse 117 alias ticrate impulse 118 alias autoid impulse 119 alias ready impulse 120 alias notready impulse 121 alias unlock impulse 122 alias ready? impulse 123 alias timerstop impulse 124 alias timerstart impulse 125 alias ghostcode echo You do not have a ghost alias ghost impulse 127 alias score impulse 128 alias help-match impulse 129 alias lock impulse 130 alias +teamscores "+showscores;impulse 131" alias -teamscores "-showscores;impulse 132" alias rockets impulse 133 alias observer impulse 140 alias walk impulse 141 alias flyme impulse 142 alias chase impulse 143 alias chasecam impulse 143 alias help-walk impulse 144 alias help-fly impulse 145 alias help-chase impulse 146 alias commentary impulse 147 alias headsup impulse 148 alias eyecam impulse 149 alias tourney impulse 151 alias camera impulse 153 alias autocam impulse 154 alias autocamera impulse 154 alias quaketv impulse 154 alias autochase impulse 155 alias help-camera impulse 156 alias killstats impulse 170 alias efficiency impulse 171 alias eff impulse 171 alias stats impulse 172 alias quadstats impulse 173 alias badstats impulse 174 alias teamstats impulse 175 alias flagstats impulse 176 alias autostats impulse 178 alias red ";color 4;w5;ready;" alias blue ";color 13;w5;ready;" alias help-stats impulse 179 alias sm1 "echo Smoothing ON ; cl_nolerp 1 ; alias smooth sm0" alias sm0 "echo Smoothing OFF ; cl_nolerp 0 ; alias smooth sm1" alias smooth sm1 alias init echo alias +hook impulse 98 alias -hook impulse 97 alias hook impulse 22 alias dropammo impulse 20 alias rune-use impulse 20 alias dropweapon impulse 21 alias flagstatus impulse 23 alias rune-tell impulse 23 alias droprune impulse 19 alias rune-delete impulse 19 alias nextmap impulse 204 alias vote-exit impulse 204 alias faststart impulse 209 alias afk impulse 70 clanring_set_aliases -zone Type for help Type or to join clanring_pre_set_aliasesclanring_ignorethis;wait;wait clanring_ghostghost clanring_send_ignore_thisname player clanring_init_thinkmatch mode deathmatch mode practice mode classic mode clanring_show_modealias coop screenshot alias detect impulse 62 alias gl_texturemode alias detect impulse 60 gl_texturemode detect clanring_send_detectclanring_check_player_in_listclanring_put_player_in_listclanring_remove_player_from_listban 255.255.255.255 ban_kick_clientalias udpport impulse 61 ;udpport; alias udpport " "; checking qbot... alias -flipleft impulse 165 ;-flipleft; alias -flipleft " "; checking richmark alias reset_eyecam "impulse 160" ;reset_eyecam; alias reset_eyecam " ";wait checking glpro8 alias phocu "impulse 161" phocu alias phocu " "; checking phocus validated detected Client failed the security scan, NoBotsfind_pqc_teamscore_teams has connectedclanring_client_connectclanring_client_disconnectbf clanring_bf_thinkclanring_observer_start_thinkclanring_put_client_in_serverHelp commands (type in console): vinfo - server version info help-misc - misc commands help-observer - observer commands help-match - match mode help help-stats - statistics help help-admin - admin commands commands - list commands/impulses clanring_help Type to change maps clanring_help_change admin - enter admin code admins - list server admins setquad - enable/disable quad setpent - enable/disable pent setring - enable/disable ring setrunes - enable/disable runes sethook - enable/disable grappling hook normal - request FFA play practice - request practice mode match - request match mode nogibs - disable gibs lowgibs - set gibs to 'low' highgibs - set gibs to 'high' motd - show message of the day commands - list commands/impulses observer - toggle observer mode warp - choose a map for vote to load rules - view server rules ticrate - view sys_ticrate autoid - toggle auto teammate identify autoweapon - toggle smartweapon autopause - toggle auto pausing clanring_help_miscclanring_info vinfo help-server help-misc help-match help-observer help-walk help-fly help-chase help-camera commands levels autoweapon admin motd observer walk flyme chase eyecam camera autochase autocam headsup smoothN/A tourney yes no ready notready ready? unlock lock timerstop timerstart +teamscoresN/A -teamscoresN/A timeset otset ghostcodeN/A ghost score nogibs lowgibs highgibs setquad setpent setring normal practice match deathmatch ticrate killstats efficiency stats quadstats badstats autostats help-stats commentary obits rules rockets autopause admins teamstats flagstats sethook setrunes autoid +hook -hook droprune dropammo dropweapon flagstatus hook nextmap help-admin options safepractice kick! abortmatch ghostlist modevote spot nextspawn makespawn nextcam makecam dmset ips maxteams faststart autoss ban! clanring_commandstype to change maps clanring_levelsreply from "clanring_ping_replyYou have entered an invalid impulse. Your bindings may be incorrect - try reconnecting to the server. clanring_bad_impulse Adapted from the Elohim Server compiled with FrikQCC clanring_vinfoclanring_ticrateCRCTF match mode CRMod match mode ctf practice mode practice mode Public CTF mode Public Team DeathMatch mode FFA DeathMatch mode deathmatchteamplaytimelimitfraglimitovertimeovertimedisabled overtimesudden death noexitquad pentringruneshookno spoogeon clanring_show_rulesThere are no administrators clanring_adminsclanring_wingl_detectchecking Press FIRE or JUMP to disable '' status. Automatic Team Identifierctf impulse Smart weapon switchingFound old bindings invalid command. type '' in console for list. type 'help-server' in console for help clanring_impulse kicked for suicidingyou have suicides remaining clanring_client_suicide kicked for observer spammingclanring_client_readyplay demon/idle1AFK ALERT: . Press jump or fire to stay connected. clanring_periodic_checksTimelimit Hit -- Game Over! impulse 39 is . lag protection activated. levels.cfg: finished no nextmap found nextmap is Exits activated     temp1clanring_start_frameitems/itembk2.wavRegenFlag flag has been returned to base! flag has been returned to base! Enemy has been returned to base!Your has been returned to base!TeamCaptureReturnFlagTeamCaptureRegenFlagsFLAG: drop - no owner?!?! the flag! the flag!TeamDropFlagTeamCaptureDropFlagOfPlayerFlags are in practice mode. the ! the !堐 TEAM captured the blue flag! TEAM captured the red flag! Your team captured the flag! gets an assist for returning the ! gets an assist for fragging the carrier!Your flag was captured! the ! the ! the ! the !match has not begun flag has been taken flag has been takenYour has been taken!Your team has the enemy !TeamCaptureFlagTouchflag_check_sizeFlag in invalid state progs/flag.mdlTeamCaptureFlagThinkFlags are missing blue flag red flag blue flag red flag missing at base on the field lost blue flag red flag blue flag red flag on field TeamFlagStatusReportFlag fell out of level at place_flagmisc/flagtk.wavmisc/flagcap.wavdoors/runetry.wavprogs/w_g_key.mdlmisc/medkey.wavdoors/meduse.wavboss2/pop2.wavitem_flag_team1progs/w_s_key.mdlitem_flag_team2func_clanring_wallinfo_player_deathmatchno info_player_deathmatch to spawn runeSelectRuneSpawnPointYou already have a rune. you got the rune of ! you got the rune of ! you got the rune of ! you got the rune of ! misc/runekey.wavRuneTouchRuneRespawnprogs/end1.mdlprogs/end2.mdlprogs/end3.mdlprogs/end4.mdlitem_runeDo_DropRuneDropRuneSpawnRunesStartRuneSpawnStartRuneSpawnStartTossRunestats_reset_playerstats_reset_teambadstats valid in match mode only paks - number of RL paks given away self - percent damage done to self team - percent damage done to team paks self team name stats_show_badstats-Quad Stats- quads - quads picked up eff - quad weapon efficiency opp - number of opponents killed slf - number of times killed self tm - number of teammates killed quadseffoppslftm name stats_show_quadstats-Kill Stats- opp - number of opponents killed slf - number of times killed self tm - number of teammates killed kld - number of times killed by enemy dtk - amount of damage taken dgv - amount of damage given fragsoppslftm kld dtk dgv name stats_show_killstats%N/Astats_print_percent3-Efficiency Stats- bul - bullet efficiency nls - nail efficiency rox - rocket efficiency lg - lightning gun efficiency bulnlsroxlg total name stats_show_efficiency-Flag Stats- flag pickups cap captures def defenses rtn returns fcd carrier defenses fca carrier assists fck flag carriers killed time best capture time flag capdefrtnfcdfcafck time name stats_show_fstats-Stats Summary- kill - kill efficiency weapn - weapon efficiency team kill weapn name kill weapn name stats_show_summarystats_format_vectorTeamstats valid in match mode only No teams Teamstats available to observers only Q ̎ǎ ǎǎ 렫 젠 %stats_show_teamstats stats_autodumpStatistics commands: stats - summarize statistics killstats - list player kill stats efficiency - list player efficiency quadstats - list player quad stats badstats - team game blunders teamstats - various team statistics autostats - automatically dump stats at the end of matches stats_helpAutostatsstats_impulseBlue Score: Blue Score : Red Score: Red Score : 䑺teamplay_show_scoreBlue team with frags. Red team lost with Red team with Blue team lost with Š of teamplay_show_final_score;color 4 ;color 13 teamplay_verify_team was to the BLUE team. has joined the BLUE team. was to the RED team. has joined the RED team. ;color 4; teamplay_ready_playerteamplay_force_player_readyteamplay_final_statsscore_init Tied at score_init_world Play On! score_check_sudden_deathscore_get_top2score_fragscore_write_namescore_write_fragsscore_write_colourMatch OverSudden death remainingscore_write_timescore_fix_connectscore_client_connectscore_fix_disconnectscore_client_disconnectscore_show_teamscoresscore_restore_scoreboardscore_update_fragsscore_update_timescore_resend_scoreboardquaketv_soundquaketv_stuffcmdquaketv_announce2quaketv_announce3quaketv_announce4quaketv_announce5The has controlplay doors/drclos4;play doors/drclos4;play doors/drclos4 quaketv_announce_controlquaketv_check_control got a rocket launcher!misc/talkquaketv_obtained_rl lost controldemon/dland2quaketv_lost_rlthe thrdnd time in a row for quaketv_powerup_obtainedobserver_find_teleportobserver_spawn_tfogobserver_check_teleportobserver_clear_flagsobserver_check_demo_endsm0 cl_nolerp 0 v_centerspeed 500 walk mode - help-walk for help type 'headsup' for fullscreen display observer_walk_startfly mode - help-fly for help observer_fly_startno cameras found info_intermissionv_centerspeed 0 camera mode - help-camera for help Automatic Cameras Enabled. type 'autocam' for automatic camera switching type 'smooth' to eliminate choppines observer_camera_startno chase target found chase mode - help-chase for help Automatic Chasecam Enabled. type 'autochase' for automatic chase switching Tournament Mode Enabled. observer_chase_starteyecam mode - help-chase for help observer_demo_start?Observer_Start: self.deadflag != DEAD_NO, respawning ;color 0; viewsize 120 observer_startviewsize 100 Observer mode offobserver_endobserver_find_cameraobserver_next_cameraobserver_prev_cameraobserver_find_targetobserver_next_targetobserver_prev_targetobserver_look_for_targetobserver_get_targetNo more chase targets observer_disconnect_notifyobserver_find_enemyobserver_set_chase_positionobserver_set_demo_positionobserver_set_camera_positionObserver commands: help-walk - help-fly - help-chase - help-camera - ready - walk/flyme > chase/eyecam > autochase - camera - autocam - headsup - tourney - commentary - observer_helpWalk mode controls: jump - attack - help-observer - observer_walk_helpFly mode controls: jump - attack - observer_fly_helpChase/eyecam mode controls: attack - jump - attack+jump - smooth - autochase - tourney - observer_chase_helpCamera mode controls: jump - attack+jump - observer_camera_helpCancelled observer_cancel_leaveLeave match? Type yes to confirm. observer_confirmobserver_confirm_leave_responseRunning commentarysmooth Tournament chasecam modeYou must be an observer first observer_impulseobserver_jumpobserver_check_size observer_update_displayobserver_update_status_barobserver_set_originobserver_fly_through_obstacleobserver_fly_moveobserver_pre_thinkobserver_post_thinkobserver_door_touchHeads up display disabled Heads up display enabled observer_heads_upThere is already a vote in progress Observers cannot initiate votes during match. clanring_requestvote_initvote_clear Wise man say: "Vote early, vote often" voted. vote_yesvote_novote_majority Type or in console to vote misc/talk.wavvote_repeatvote_accept vote_rejectNothing to vote on vote_impulseteammatch_init_worldtimelimit "Final Score is <> - : Waiting for s" : Match Starting" Sudden death" match_show_timelimitmatch_item_resetmatch_init_playermatch_unready_playeritem_backpackNo teams presentclanring_match_timermatch_resetcolor 0 match_gib_player has fragmatch_bprint_scoreSudden death overtimeTime remaining: "Time remaining: match_bprint_timeMatch begins in secondWaiting for s Match over Sudden death overtime match_sprint_statusmatch_check_autossMatch tied - Overtime!! minutes remainingMatch tied - Sudden Death Overtime!!No match in progress Tie game! has wonThe match is overmatch_endMatch ends in minutesMatch ends in 1 minuteMatch ends in 30 seconds minute overtime in case of tieSudden death overtime in case of tieMatch ends in T minusmatch_timer_think2clanring_start_pointmatch_add_spawnmatch_remove_startmatch_remove_startsmatch_count_playersmatch_get_maxsizematch_reset_ownerThe match has begun!Match is vitem_super_damagematch_begin match_bprint_timelimitmatch_reset_powerupUse '' to change timelimit All items have respawned- Quad is Quad is OFF - Pent is Pent is OFF - Ring is Ring is OFF - Match begins in 30 secondsMatch is currently Match begins in 20 secondsMatch begins in T minusmatch_timer_think1match_delete_teamsInvalid pants color type or to join match You are already on a team Team full. A player must enter 'unlock' in console to let you join has joined the Only one team presentThere are already teams: (color clanring_team createdmatch_put_player_in_teammatch_all_readyMatch begins in 1 minutematch_start_timermatch_find_ghostalias ghostcode echo Your ghost code is alias ghost "impulse 127;w5;impulse ;w5;impulse match_send_ghost_aliasesghostcode match_make_ghostThere is no match in progress You are already in the match Enter the first ghost code digit: match_request_restore_ghostEnter the second ghost code digit: Ghost not found owns this ghost match_enter_ghost_codecolor restored from ghost with match_restore_ghostTry again in 5 seconds You are already committed Finish entering the ghost code match_readymatch_remove_playermatch_remove_teamYou have not yet committed Cannot uncommit during match Type 'observer' to leave match is not readyOnly one presentNo s presentTimer stoppedmatch_notreadyMatch has been unlockedNew players may join at willmatch_unlockMatch is already unlocked unlock comand available to match participants and administrators only match_request_unlockMatch has been lockedMax teamsize set to Max number of players set to match_lockMatch is already locked lock comand available to match match_request_lockMatch commands (for match mode only): ready - notready - otset - timeset - ready? - unlock - lock - timerstop - timerstart - ghostcode - ghost - score - +teamscores - rockets - match_helps present All players are ready present The following players are not ready: match_show_not_readymatch_pause_itemmatch_pause_player Ć match_show_pauseMatch pausedmatch_pauseMatch is already paused match_request_pausematch_unpause_itemmatch_unpause_playermatch_unpause_ghostMatch unpausedmatch_unpausematch_unpause_countdown_thinkMatch restarts in T minus 5match_start_unpause_countdownTimer has already started There are no There is only one Match is not paused match_request_unpauseCommand valid in match mode only The following players have RLs: Nobody has a rocket launcher match_show_rocketsYou are not an observer match_impulse has become tried to change colorYou cannot change color after you have committed match_verify_teamInternal error #3. Clanring autopause activated 堧timerstart Internal error #1. Match abortedInternal error #2. match_disconnect_notifyairshot_pop_player_up(height: airshot_damage_zalias w5 "wait;wait;wait;wait;wait" alias sethook impulse 202 alias setrunes impulse 203 alias autopause impulse 210 alias obits impulse 211 alias timeset impulse 215 alias otset impulse 216 alias setquad impulse 221 alias setpent impulse 222 alias setring impulse 223 alias nogibs impulse 225 alias lowgibs impulse 226 alias highgibs impulse 227 alias normal impulse 217 alias practice impulse 218 alias match impulse 219 alias dm impulse 220 alias ctf impulse 220 alias 0 impulse 230 alias 1 impulse 231 alias 2 impulse 232 alias 3 impulse 233 alias 4 impulse 234 alias 5 impulse 235 alias 6 impulse 236 alias 7 impulse 237 alias 8 impulse 238 alias 9 impulse 239 alias 10 impulse 240 alias 11 impulse 241 alias 12 impulse 242 alias 13 impulse 243 alias 14 impulse 244 alias 15 impulse 245 alias clanring_ignorethis "impulse 180 ; sm0" votables_send_aliasesgrappling hook has been grappling hook has been votables_set_hookdisable grappling hookenablevotables_request_set_hookvotables_change_levelInvalid level votables_request_change_levelvotables_init_warpprogs/v_shot.mdlvotables_starve_playerprogs/v_rock2.mdlvotables_phatten_playerplaymode set to ''votables_set_modeWait for levels.cfg to finish Already in Cannot change mode while match is in progress Match has started; cannot change mode Mode voting has been disabled Practice mode has been disabled votables_request_set_modevotables_set_gametypeCannot change gametype while match is in progress Team DeathMatchCapture The Flagvotables_request_set_gametypeCannot change time limit while match is in progress. Match length changed to timelimit changed to minutes votables_set_timelimit votables_request_set_timelimitinvalid selection votables_get_timelimitSelect timelimit: votables_select_timelimitCannot change overtime while match is in progress. Overtime set to Sudden DeathOvertime disabledOvertime changed to votables_set_overtime votables_request_set_overtimevotables_get_overtimeSelect overtime: votables_select_overtimeGibs disabledGibs set to 'low'Gibs set to 'high'votables_set_gibsGibs already disabled "Gibs already set to 'low'" Gibs already set to 'low' "Gibs already set to 'high'" Gibs already set to 'high' votables_request_set_gibsvotables_disable_itemQuad enabledQuad disabledvotables_set_quadStop fucking with the quad votables_request_set_quadvotables_vote_exitCommand not allowed in match mode. otherwise, use WARP to specify map. exit to next level.votables_request_vote_exitPentagram enabledPentagram disabledvotables_set_pentStop fucking with the pentagram votables_request_set_pentRing of shadows enabledRing of shadows disabledvotables_set_ringStop fucking with the ring votables_request_set_ringExtended obituariesvotables_set_obits votables_request_set_obitsAutomatic match pausingvotables_set_autopause votables_request_set_autopauseRunes Disabled Runes Enabled votables_set_runes votables_request_set_runesFast match startsvotables_set_faststarts fast match startsvotables_request_set_faststartsalias qsmack impulse 37 alias help-admin impulse 200 alias autoss impulse 204 alias ban! impulse 205 alias ips impulse 206 alias dmset impulse 207 alias maxteams impulse 208 alias ghostlist impulse 212 alias kick! impulse 213 alias skick impulse 213 alias abortmatch impulse 214 alias safepractice impulse 224 alias modevote impulse 228 alias options impulse 229 alias nextspawn impulse 246 alias makespawn impulse 247 alias nextcam impulse 248 alias makecam impulse 249 admin_send_aliasesYou are now an administrator has become an administrator (code ) admin_createInvalid code kicked for admin hackingEnter the next code digit: admin_enter_codeAdministrator password disabled Type 'exec crctf.cfg' in server console to set password. You are no longer an administrator Enter the first code digit: admin_start_code ip address name admin_show_ip_listWhich player do you want to kick? 0 cancel admin_print_kick_choiceThere is already a kick in progress There is no-one to kick clanring_kick_timeoutadmin_start_kickInvalid is an administrator kick ? admin_confirm_kickadmin_confirm_kick_responseadmin_do_kickKick cancelled admin_cancel_kickWhich player do you want to ban? admin_print_ban_choiceAdministrator function already in progress There is no-one to ban admin_start_banadmin_confirm_banadmin_confirm_ban_responseadmin_do_banadmin_cancel_banThere are no ghosts code team frags name code colour frags name Disconnected admin_list_ghosts origin: angle : admin_show_spot_infoYou must be in walk or fly mode No spawn points found admin_next_spawn_pointYou must be in walk mode You must be on the ground Cannot create underwater spawn point Max. number of spawn points reached Spawn point created admin_make_spawn_pointYou must be in fly mode No cameras found admin_next_cameraMax. number of cameras reached Camera created admin_make_cameraAdmin only commands: autoss - automatic screenshots maxteams - set max number of teams kick! - kick a player crban - ban a player modevote - enable/disable mode votes options - on-screen options menu dmset - change deathmatch mode faststart - toggle fast match start abortmatch - abort current match ghostlist - view list of ghosts spot - show location/angles nextspawn - go to next spawn point makespawn - add spawn point nextcam - go to next camera makecam - add camera safepractice - no spam/discharging admin_helpdeathmatch deathmatch changed to admin_dmsetMaximum number of teams set to admin_set_maxteamsadmin_get_maxteamsEnter maximum number of teams: admin_choose_maxteamsclanring_screenshot_entityadmin_dm3_screenshot_cleanupcoop 0 admin_dm3_screenshotadmin_screenshot_spawnautoss will be taken at end of match autoss -showscores;impulse 128;wait echo "echo "" name progs/armor.mdlprogs/player.mdlprogs/quaddama.mdlprogs/invulner.mdlprogs/invisibl.mdlprogs/spike.mdlprogs/g_shot.mdlprogs/g_nail.mdlprogs/g_nail2.mdlprogs/backpack.mdlprogs/g_rock.mdlprogs/g_rock2.mdlprogs/g_light.mdlprogs/s_spike.mdlmaps/b_bh100.bspprogs/s_bubble.sprprogs/bolt.mdlprogs/bolt3.mdlprogs/bolt2.mdlprogs/missile.mdlprogs/s_explod.sprprogs/grenade.mdlmaps/b_rock0.bspmaps/b_rock1.bspmaps/b_batt0.bspmaps/b_batt1.bspmaps/b_bh10.bspmaps/b_bh25.bspadmin_dm3_screenshot_setup is using GL Quake! No autoss taken (take it after match) " wait;screenshot name " wait;coop 0 is using GL Quake +showscores; " scr_conspeed 9999;path;name;wait;coop 0;toggleconsole;wait;coop 0;-showscores;toggleconsole admin_auto_screenshotSafe practice modeMode votingadmin_impulseadmin_disconnect_notifySUB_regenBonus item fell out of level at PlaceItemStartItemT_Healitems/r_item1.wavitems/r_item2.wavitems/health1.wavitem_healthhealth_rotMakeHealthRotYou receive health health_touchitem_megahealth_rotitems/armor1.wavarmor_touchitem_armor1item_armor2item_armorInvbound_other_ammoRankForWeaponDeathmatch_Weaponweapon_touch: unknown classnameweapons/pkup.wavweapon_touchDouble-barrelled Shotgunweapon_supershotgunNailgunweapon_nailgunSuper Nailgunweapon_supernailgunGrenade Launcherweapon_grenadelauncherRocket Launcherweapon_rocketlauncherThunderboltweapon_lightningweapons/lock4.wavammo_touchmaps/b_shell1.bspmaps/b_shell0.bspshellsitem_shellsmaps/b_nail1.bspmaps/b_nail0.bspnailsitem_spikesrocketsitem_rocketscellsitem_cellsitem_weaponitem_key1item_key2item_sigilpowerup_touchitems/protect.wavPentagram of Protection got the pentagram got the item_artifact_invulnerabilityitems/suit.wavprogs/suit.mdlBiosuititem_artifact_envirosuititems/inv1.wavRing of Shadows is invisible is Invisible item_artifact_invisibilityitems/damage.wavQuad Damage got the quad got the item_artifact_super_damageYou get got 's RL, shells nails rockets cellsBackpackTouchAxeShotgunDropBackpackTeam_weapon_touchcheck_weapon_toss_timeYou can only drop each weapon, once, every 20 seconds. weaponnailgunTossWeaponTeam_Ammo_Touchnot enough ammo. TossAmmoalias sping temp1 1 alias time temp1 2 alias s temp1 3 alias debug temp1 4 alias score temp1 5 alias ghostlist temp1 6 alias killstats temp1 7 alias efficiency temp1 8 alias eff temp1 8 alias stats temp1 9 alias commands temp1 10 alias vinfo temp1 11 alias normal temp1 12 alias ffa temp1 12 alias practice temp1 13 alias match temp1 14 alias crmod temp1 15 alias quadstats temp1 16 alias badstats temp1 18 alias teamstats temp1 19 alias admins temp1 90 alias settings temp1 17 alias safepracticeon "temp1 20;wait;" alias safepracticeoff "temp1 21;wait;" alias nogibs "temp1 22;wait;" alias lowgibs "temp1 23;wait;" alias highgibs "temp1 24;wait;" alias quadon "temp1 25;wait;" alias quadoff "temp1 26;wait;" alias penton "temp1 27;wait;" alias pentoff "temp1 28;wait;" alias ringon "temp1 29;wait;" alias ringoff "temp1 30;wait;" alias modevoteon "temp1 31;wait;" alias modevoteoff "temp1 32;wait;" alias obitson "temp1 33;wait;" alias obitsoff "temp1 34;wait;" alias setovertime "temp1 36;wait;" alias maxteams "temp1 37;wait;" alias faststarton "temp1 38;wait;" alias faststartoff "temp1 39;wait;" alias freshspawnson "temp1 40;wait;" alias freshspawnsoff "temp1 41;wait;" alias nopractice "temp1 42;wait;" alias autopauseon "temp1 43;wait;" alias autopauseoff "temp1 44;wait;" alias autostatson "temp1 45;wait;" alias autostatsoff "temp1 46;wait;" alias runeson "temp1 47;wait;" alias runesoff "temp1 48;wait;" alias newspawn "temp1 50;wait;" alias newstart "temp1 51;wait;" alias killspawn "temp1 52;wait;" alias makecam "temp1 53;wait;" alias killitem "temp1 54;wait;" alias makeitem "temp1 55;wait;" alias changeitem "temp1 56;wait;" ;alias setafk "temp1 57;wait;" ;alias kickafk "temp1 59;wait;" alias [init] "temp1 60;wait;" alias [normal] "temp1 61;wait;" alias [practice] "temp1 62;wait;" alias [match] "temp1 63;wait;" alias [crmod] "temp1 64;wait;" alias [done] "temp1 65;wait;" ;alias dynamichookoff "temp1 66;wait;" ;alias dynamichookon "temp1 67;wait;" ;alias safedischargeon "temp1 68;wait;" ;alias safedischargeoff "temp1 69;wait;" ;alias tossruneoff "temp1 35;wait;" ;alias tossruneon "temp1 58;wait;" alias debugclient temp1 70 alias debugoff temp1 71 alias stuffimpulse temp1 72 alias stuffcolor temp1 73 alias debugcflags temp1 74 alias debugsflags temp1 75 alias debugcinfo temp1 76 alias debughelp temp1 77 alias setpass "temp1 80;wait;" alias setpass1 "temp1 81;wait;" alias setpass2 "temp1 82;wait;" alias setpass3 "temp1 83;wait;" alias setpass4 "temp1 84;wait;" alias setpass5 "temp1 85;wait;" alias setpass6 "temp1 86;wait;" alias setpass7 "temp1 87;wait;" alias setpass8 "temp1 88;wait;" alias setpass9 "temp1 89;wait;" ;alias banned "temp1 91;wait;" ;alias * "temp1 1256;wait" alias "temp1 ;wait;" console_set_aliasesbuiling byte aliases. console_byte_aliasesclient ping times: " console_ping_thinkimpulse 38 clanring_pingconsole_ping"time = console_show_timestatus;echo console_show_status" - Connected " - Disconnected console_show_debug_info" has console_show_score" code | team | frags | name" " code | colour | frags | name" ------+------------+-------+----------------- " | | | | | | Disconnected" console_list_ghosts"------------" " Kill Stats " " frags | enemies | self | teammates | killed | dtk | dgv | name" -------+---------+------+-----------+--------+-----+-----+----------------- | | | | ||| console_show_killstatsN/A console_print_percent4" Quad Stats " " quads | efficiency | enemy | self | teammates | name" -------+------------+-------+-------+-----------+----------------- | | " [] | | | | | console_show_quadstats" Bad Stats " " paks | self | team | name" "------+------+------+----------------" console_show_badstats"------------------" " Efficiency Stats " " bullets | nails | rockets | lightning | total | name" ---------+-------+---------+-----------+-------+----------------- | console_show_efficiency" Flag Stats " "------------------------------------------------------" "flag |cap|def|rtn|fcd|fca|fck| time | name " "-----+---+---+---+---+---+---+--------+---------------" " |console_show_fstats" Skill Stats " " team | kill | weapon | name" ------------+------+--------+----------------- " kill | weapon | name" ------+--------+----------------- console_show_statsconsole_format_vector" Team Stats " " | "---------------+--------------"Q : 666 : Ring "RL : LG : GL "SNG : NG : MH "RA : YA : GA "+RLPak : -RLPak+-"Control | %console_show_teamstats"Clanring CRCTF v -Match Statistics-" "Map: console_autodump console commands:" "s - view server status settings - view server settings " "vinfo - version information ghostlist - view list of ghosts " "sping - approximate client pings setpass - set password (use 'skill')" "time - time elapsed on current map maxteams - set maxteams (use 'skill')" "score - match score/time remaining otset - set overtime (use 'skill')" "admins - list administrators" "stats killstats efficiency quadstats badstats teamstats" "settings:" "normal practice match deathmatch" "nopractice highgibs lowgibs nogibs" "quadon quadoff penton pentoff" "ringon ringoff freshspawnon freshspawnoff" "faststarton faststartoff autopauseon autopauseoff" "modevoteon modevoteoff safepracticeon safepracticeoff" "obitson obitsoff autostatson autostatsoff" console_commandsskill"debugging client not found console_debug_clientNo debug client impulse stuffing impulse console_stuff_impulsestuffing color console_stuff_colour"Client flags for :" "Client Observer Flags for console_client_flagsconsole_server_flags"debugclient - select client (use 'skill')" "debugoff - deselect client" "stuffimpulse - stuff impulse (use 'skill')" "stuffcolor - stuff colour (use 'skill')" "debugcflags - show client flags" "debugcinfo - show client info" "debugsflags - show server flags" console_debug_help"think = "nextthink = "current time = console_client_infoconsole_version_infoconsole_check_levelexec levels.cfg console_get_user_nextlevelscr_ofsxscr_ofsyscr_ofszconsole_get_originv_ipitch_levelv_iyaw_levelv_iroll_levelconsole_get_angles created at console_make_entityremoved at "killentity: couldn't find console_kill_entityconsole_kill_itemconsole_make_itemconsole_change_itemconsole_onofftimelimit fraglimit teamplay deathmatch pausable sys_ticrate autopausing: console_show_settingsconsole_set_max_teams" Code | Name" "------+-----------------" console_adminsPlayers will be declared AFK after minutes of inactivity. AFK Players will be kicked after minutes. practice mode disabled Console autostatsRunes Enabledpassword set debugging off unknown command console_command options_szmode options_sztimelimit options_szfraglimit options_szovertime options_szgibs options_szteamplay options_sznoexit 宮 宮 宮 宮 宮 宮 宮 宮 options_szpausable options_szdeathmatch options_szticrate options_szquad options_szpent options_szring options_szmode_vote options_displayoptions_get_modeoptions_get_gibsplay misc/menu2.wav options_start_settingplay misc/menu3.wav options_changepausable changed to 0.050.060.070.080.090.1sys_ticrate changed to options_finish_settingplay misc/menu1.wav options_pre_thinkSUB_NullSUB_RemoveSUB_FreezeSetMovedirInitTriggerSUB_CalcMoveEntNo speed is defined!SUB_CalcMoveSUB_CalcMoveDoneDelayThinkDelayedUseSUB_UseTargetsdischargeCanDamageKilledLag Protectiondoordrowninghook: items/protect3.wav healthT_DamageT_RadiusDamageident_update_displayident_get_targetweapons/bounce2.wavhook2_entityHookVanish2shambler/smack.wavblob/land1.wavweapons/chain2.wavweapons/chain3.wavHookPull2player/axhit2.wavT_ChainTouch2Hook_Check2LinkPos2progs/v_spike.mdlhknight/hit.wavweapons/chain1.wavW_FireHook2HookFire2HookOff_eHookOffweapons/r_exp3.wavweapons/rocket1i.wavweapons/sgun1.wavweapons/guncock.wavweapons/ric1.wavweapons/ric2.wavweapons/ric3.wavweapons/spike2.wavweapons/tink1.wavweapons/grenade.wavweapons/bounce.wavweapons/shotgn2.wavknight/sword1.wavprogs/star.mdlprogs/bit.mdlprogs/v_star.mdlrune/rune1.wavrune/rune2.wavrune/rune22.wavrune/rune3.wavrune/rune4.wavW_PrecachecrandomBecomeExplosionW_FireAxewall_velocitygibsprogs/zom_gib.mdlSpawnMeatSpraySpawnBloodspawn_touchbloodSpawnChunkClearMultiDamageApplyMultiDamageAddMultiDamageTraceAttackFireBulletsW_FireShotgunW_FireSuperShotgunrocketT_MissileTouchW_FireRocketLightningDamageweapons/lhit.wavW_FireLightningGrenadeExplodeGrenadeTouch W_FireGrenadelaunch_spikeW_FireSuperSpikesW_FireSpikesnailwizspikeknightspikespike_touchsupernailsuperspike_touchprogs/v_axe.mdlprogs/v_shot2.mdlprogs/v_nail.mdlprogs/v_nail2.mdlprogs/v_rock.mdlprogs/v_light.mdlW_SetCurrentAmmoW_BestWeaponW_CheckNoAmmoweapons/ax1.wavweapons/lstart.wavW_Attackhook has been disabled. use to vote hook. no weapon. W_ChangeWeaponCycleWeaponCommandCycleWeaponReverseCommandPreviousWeaponCommandImpulseCommandsW_WeaponFrameitems/damage3.wavSuperDamageSoundRegenerationSoundResistanceSoundboss1/sight1.wavHasteSoundenforcer/enfstop.wavLaser_Touchmonster_enforcerenforcer/enfire.wavprogs/laser.mdlLaunchLasermainmaps/e1m8.bspsv_gravity800demon/dland2.wavmisc/h2ohit1.wavplayer/plyrjmp8.wavplayer/land.wavplayer/land2.wavplayer/drown1.wavplayer/drown2.wavplayer/gasp1.wavplayer/gasp2.wavplayer/h2odeath.wavplayer/teledth1.wavmisc/r_tele1.wavmisc/r_tele2.wavmisc/r_tele3.wavmisc/r_tele4.wavmisc/r_tele5.wavmisc/power.wavplayer/gib.wavplayer/udeath.wavplayer/tornoff2.wavplayer/pain1.wavplayer/pain2.wavplayer/pain3.wavplayer/pain4.wavplayer/pain5.wavplayer/pain6.wavplayer/death1.wavplayer/death2.wavplayer/death3.wavplayer/death4.wavplayer/death5.wavplayer/axhit1.wavplayer/h2ojump.wavplayer/slimbrn2.wavplayer/inh2o.wavplayer/inlava.wavmisc/outwater.wavplayer/lburn1.wavplayer/lburn2.wavmisc/water1.wavmisc/water2.wavmisc/menu1.wavmisc/menu2.wavfish/bite.wavprogs/h_player.mdlprogs/gib1.mdlprogs/gib2.mdlprogs/gib3.mdlprogs/lavaball.mdlitems/protect2.wavitems/suit2.wavitems/inv2.wavitems/inv3.wavitems/damage2.wavzombie/z_pain.wavhknight/slash1.wavmmmnmmommommnonmmonqnmmoabcdefghijklmnopqrstuvwxyzyxwvutsrqponmlkjihgfedcbammmmmaaaaammmmmaaaaaabcdefgabcdefgmamamamamamajklmnopqrstuvwxyzyxwvutsrqponmlkjnmonqnmomnmomomnommmaaaabcdefgmmmmaaaammmaammmmmaaammmaaammmabcdefaaaammmmabcdefmmmaaaaaaaaaaaazzzzzzzzmmamammmmammamamaaamammmaabcdefghijklmnopqrrqponmlkjihgfedcbaaworldspawn;restart; StartFramebodyquernd_numberinfo_intermissionSetChangeParmsSetPracticeParmsSetNewParmsSetNewParms2DecodeLevelParmsinfo_player_starttestplayerstartFindIntermission: no spotFindIntermission Loading Map...Please Wait. GotoNextMapIntermissionThinkfexecute_changelevelpre_execute_changelevelplay misc/talk.wav Exits not yet activated exited the levelchangelevel_touchchangelevel trigger doesn't have maptrigger_changelevelrespawnThe match is paused; you cannot suicide. suicidesClientKillinfo_player_team1info_player_team2TeamCaptureSpawnCan not find an 'info_player_deathmatch' spawnpoint on this map!info_player_start2PutClientInServer: no info_player_start on levelSelectDeathmatchSpawnPointSelectSpawnPointplayer_touchmove_to_intermissionproto_intermissionPutClientInServerinfo_player_startinfo_player_start2testplayerstartinfo_player_deathmatchinfo_player_team1info_player_team2info_player_coopregisteredtrigger_changelevelNextLevelPlayerDeathThinkPlayerJumpWaterMoveCheckWaterJump;color 4, 4; ;color 13, 13; PlayerPreThinkadmin_pushplayersRing of Shadows magic is fading Protection is almost burned out Quad Damage is wearing off Air supply in Biosuit expiring CheckPowerupsfallingPlayerPostThinkClientConnectsomeone left the game with disconnected.ClientDisconnectFraglimit Hit -- Game Over! Game won in client_fragteledeath telefragged his teammate was telefragged by teledeath2Pentegram power deflects 's telefragteledeath3's protection.squish squished a teammate squishes is now just a greasy spot on the floor tried to juggle too many grenades tripped over his own grenade blew himself up discovers blast radius discharged in slime discharged in lava tried to heat the pool becomes bored with quake mows down a teammate checks his glasses gets a frag for the other team loses another friend defends 's flag carrier against an agressive enemy's flag carrier defends the flag was nailed by was pierced by found 's grenade was annihilated by was blown to chunks by was obliterated by was pummelled by was pulverized by 's quad rocket rides 's rocket was hooked by was chopped into little pieces by was hacked up by was butchered by 's quad Axe's cleaver gets lead poisoned by 's shotgun got his head blown off by 's buckshot was shocked by 's thunderbolt was electrocuted by 's quad discharge's quad thunderbolt's dischargeexplo_box blew up burries himself in the ground was spikedlaser was zappedfireball coughed a lavaball tried to escape sinks like a rock forgot to come up for air discovers the hazards of toxic waste dissolves in an acidic pool burst into flames melted in lava takes a nice hot lava bath diedClientObituaryPainSoundplayer_painbubbleDeathBubblesSpawnbubble spawnerDeathBubblesDeathSound was forced because of inactivity. observerforceGibFadecorpseCreateDeadBodyPlayerDeadVelocityForDamageThrowGibThrowHeadGibPlayerPlayerDieset_suicide_framemonster_fishmonster_armymonster_dogmonster_bossmonster_demon1monster_enforcermonster_hell_knightmonster_knightmonster_ogremonster_oldonemonster_shalrathmonster_shamblermonster_tarbabymonster_wizardmonster_zombiemonster_movetarget: no targetnamemovetarget_fpath_cornerdoor_blockeddoor_hit_topdoor_hit_bottomdoor_go_downdoor_go_updoor_fire: self.owner != selfdoor_firedoor_usedoor_trigger_touchdoor_killedYou need the silver keycardYou need the silver runekeyYou need the silver keyYou need the gold keycardYou need the gold runekeyYou need the gold keydoor_touchspawn_field_triggerspawn_fieldEntitiesTouchingcross connected doorsLinkDoorsdoors/medtry.wavdoors/runeuse.wavdoors/basetry.wavdoors/baseuse.wavno worldtype set! misc/null.wavdoors/doormv1.wavdoors/hydro1.wavdoors/hydro2.wavdoors/stndr1.wavdoors/stndr2.wavdoors/ddoor1.wavdoors/ddoor2.wavfunc_doorfd_secret_usefd_secret_move1fd_secret_move2fd_secret_move3fd_secret_move4fd_secret_move5fd_secret_move6fd_secret_donesecret_blockedsecret_touchdoors/latch2.wavdoors/winch2.wavdoors/airdoor1.wavdoors/airdoor2.wavdoors/basesec1.wavdoors/basesec2.wavfunc_door_secretbutton_waitbutton_donebutton_returnbutton_blockedbutton_firebutton_usebutton_touchbutton_killedbuttons/airbut1.wavbuttons/switch21.wavbuttons/switch02.wavbuttons/switch04.wavfunc_buttontrigger_reactivatemulti_waittrigger_secretmulti_triggermulti_killedmulti_usemulti_touchmisc/secret.wavmisc/trigger1.wavhealth and notouch don't make sense trigger_multipletrigger_oncetrigger_relayYou found a secret area!trigger_secretThere are more to go...Only 3 more to go...Only 2 more to go...Only 1 more to go...Sequence completed!counter_usetrigger_counterplay_teleportspawn_tfogspawn_tfogtdeath_touchspawn_tdeathinfo_teleport_destinationfind_info_teleport_destinationteleport_touch(): couldn't find target! teleport_touchno targetnameinfo_teleport_destinationteleport_uset178t273t11T2t88no targetambience/hum1.wavtrigger_teleporttrigger_setskilltrigger_onlyregistered_touchtrigger_onlyregisteredmaps/end.bsphurt_touchtrigger_hurtambience/windfly.wavtrigger_push_touchtrigger_pushtrigger_monsterjumpplat_spawn_inside_triggerplat_spawn_inside_triggerplat_hit_topplat_hit_bottomplat_go_downplat_go_upplat_center_touchplat_outside_touchplat_trigger_useplat_crush: bad self.state plat_crushplat_use: not in up stateplat_useplats/plat1.wavplats/plat2.wavplats/medplat1.wavplats/medplat2.wavplatfunc_plattrain_blockedtrain_usetrain_waittrain_next: no next targettrain_nextfunc_train_findfunc_train without a targetplats/train2.wavplats/train1.wavtrainfunc_trainprogs/teleport.mdlmisc_teleporttrainevent_lightningeliltestinfo_nullinfo_notnulllight_uselightambience/fl_hum1.wavlight_fluoroambience/buzz1.wavlight_fluorosparkprogs/s_light.sprlight_globeambience/fire1.wavFireAmbientprogs/flame.mdllight_torch_small_walltorchprogs/flame2.mdllight_flame_large_yellowlight_flame_small_yellowlight_flame_small_whitemisc_fireballfire_flyfire_touchbarrel_damagebarrel_explodemaps/b_explob.bspitem fell out of level at misc_exploboxmaps/b_exbox2.bspmisc_explobox2spikeshooter_useshooter_thinktrap_spikeshootertrap_shooterair_bubblesmake_bubblesbubble_splitbubble_removebubble_bobviewthingfunc_wall_usefunc_wallfunc_illusionaryfunc_episodegatefunc_bossgateambience/suck1.wavambient_suck_windambience/drone6.wavambient_droneambient_flouro_buzzambience/drip1.wavambient_dripambience/comp1.wavambient_comp_humambience/thunder1.wavambient_thunderambient_light_buzzambience/swamp1.wavambient_swamp1ambience/swamp2.wavambient_swamp2enforcer/sight1.wavenforcer/sight2.wavenforcer/sight3.wavenforcer/sight4.wavenforcer/pain1.wavnoise_thinkenforcer/pain2.wavenforcer/death1.wavenforcer/idle1.wavmisc_noisemakerplayer_stand1player_runplayer_shot1player_shot2player_shot3player_shot4player_shot5player_shot6player_axe1player_axe2player_axe3player_axe4player_axeb1player_axeb2player_axeb3player_axeb4player_axec1player_axec2player_axec3player_axec4player_axed1player_axed2player_axed3player_axed4player_nail1player_nail2player_light1player_light2player_rocket1player_rocket2player_rocket3player_rocket4player_rocket5player_rocket6player_painplayer_pain1player_pain2player_pain3player_pain4player_pain5player_pain6player_axpain1player_axpain2player_axpain3player_axpain4player_axpain5player_axpain6player_diea1player_diea2player_diea3player_diea4player_diea5player_diea6player_diea7player_diea8player_diea9player_diea10player_diea11player_dieb1player_dieb2player_dieb3player_dieb4player_dieb5player_dieb6player_dieb7player_dieb8player_dieb9player_diec1player_diec2player_diec3player_diec4player_diec5player_diec6player_diec7player_diec8player_diec9player_diec10player_diec11player_diec12player_diec13player_diec14player_diec15player_died1player_died2player_died3player_died4player_died5player_died6player_died7player_died8player_died9player_diee1player_diee2player_diee3player_diee4player_diee5player_diee6player_diee7player_diee8player_diee9player_die_ax1player_die_ax2player_die_ax3player_die_ax4player_die_ax5player_die_ax6player_die_ax7player_die_ax8player_die_ax9fnstrings_functionLinkPosHookVanishUnHookPlayerHookPullT_HookTouchHook_CheckW_FireHookselfotherworldtimeframetimeforce_retouchmapnamedeathmatchcoopteamplayserverflagstotal_secretstotal_monstersfound_secretskilled_monstersparm1parm2parm3parm4parm5parm6parm7parm8parm9parm10parm11parm12parm13parm14parm15parm16v_forwardv_forward_xv_forward_yv_forward_zv_upv_up_xv_up_yv_up_zv_rightv_right_xv_right_yv_right_ztrace_allsolidtrace_startsolidtrace_fractiontrace_endpostrace_endpos_xtrace_endpos_ytrace_endpos_ztrace_plane_normaltrace_plane_normal_xtrace_plane_normal_ytrace_plane_normal_ztrace_plane_disttrace_enttrace_inopentrace_inwatermsg_entityend_sys_globalsmodelindexabsminabsmin_xabsmin_yabsmin_zabsmaxabsmax_xabsmax_yabsmax_zltimemovetypesolidoriginorigin_xorigin_yorigin_zoldoriginoldorigin_xoldorigin_yoldorigin_zvelocityvelocity_xvelocity_yvelocity_zanglesangles_xangles_yangles_zavelocityavelocity_xavelocity_yavelocity_zpunchanglepunchangle_xpunchangle_ypunchangle_zclassnamemodelframeskineffectsminsmins_xmins_ymins_zmaxsmaxs_xmaxs_ymaxs_zsizesize_xsize_ysize_ztouchusethinkblockednextthinkgroundentityhealthfragsweaponweaponmodelweaponframecurrentammoammo_shellsammo_nailsammo_rocketsammo_cellsitemstakedamagechaindeadflagview_ofsview_ofs_xview_ofs_yview_ofs_zbutton0button1button2impulsefixanglev_anglev_angle_xv_angle_yv_angle_zidealpitchnetnameenemyflagscolormapteammax_healthteleport_timearmortypearmorvaluewaterlevelwatertypeideal_yawyaw_speedaimentgoalentityspawnflagstargettargetnamedmg_takedmg_savedmg_inflictorownermovedirmovedir_xmovedir_ymovedir_zmessagesoundsnoisenoise1noise2noise3end_sys_fieldsVEC_ORIGIN_xVEC_ORIGIN_yVEC_ORIGIN_zVEC_HULL_MIN_xVEC_HULL_MIN_yVEC_HULL_MIN_zVEC_HULL_MAX_xVEC_HULL_MAX_yVEC_HULL_MAX_zVEC_HULL2_MIN_xVEC_HULL2_MIN_yVEC_HULL2_MIN_zVEC_HULL2_MAX_xVEC_HULL2_MAX_yVEC_HULL2_MAX_zmovedistgameoverstring_nullempty_floatnewmisactivatordamage_attackerframecountwadmapworldtypekilltargetlight_levstyleth_painth_diespeedleftysearch_timeattack_statewalkframeattack_finishedpain_finishedinvincible_finishedinvisible_finishedsuper_damage_finishedradsuit_finishedinvincible_timeinvincible_soundinvisible_timeinvisible_soundsuper_timesuper_soundrad_timefly_soundaxhitmeshow_hostilejump_flagswim_flagair_finishedbubble_countdeathtypemdlmanglemangle_xmangle_ymangle_zt_lengtht_widthdestdest_xdest_ydest_zdest1dest1_xdest1_ydest1_zdest2dest2_xdest2_ydest2_zwaitdelaytrigger_fieldnoise4movetargetaflagdmgcntthink1finaldestfinaldest_xfinaldest_yfinaldest_zfinalanglefinalangle_xfinalangle_yfinalangle_zcountlipstatepos1pos1_xpos1_ypos1_zpos2pos2_xpos2_ypos2_zheightmakevectorssetoriginsetmodelsetsizerandomsoundnormalizeerrorobjerrorvlenspawnremovetracelinefindprecache_soundprecache_modelstuffcmdfindradiusbprintsprintdprintftosvtosdroptofloorlightstylerintfloorceilpointcontentsfabsaimcvarlocalcmdnextentparticlevectoanglesWriteByteWriteShortWriteCoordWriteStringWriteEntitymakestaticcvar_setcenterprintambientsoundprecache_model2precache_sound2hurt_together_timehurt_nextthinkmodelindex_eyesmodelindex_playerkick_targetclanring_devparamclanring_playmodeclanring_stateclanring_timelimitdefault_timelimitclanring_overtimeclanring_nextcheckclanring_nextcheck2clanring_requestclanring_levelclanring_levelcountclanring_lastcountclanring_firstlevelclanring_num_spawnsdm_num_spawnsclanring_num_startsclanring_num_camerasclanring_versionclanring_version_infoclanring_version_numberclanring_debug_clientclanring_quadclanring_pentclanring_match_pause_timeclanring_maxteamsclanring_numteamsclanring_maxsizeclanring_match_timerclanring_sentinelclanring_sztheclanring_szteamclanring_winning_teamnameclanring_score_numberCLANRING_STRING_TIEDclanring_score_countclanring_first_placeclanring_second_placeconsole_deathmatchconsole_timelimitconsole_fraglimitconsole_pausableconsole_noexitauto_parm1auto_parm2auto_parm3auto_parm4nextmaptimelimitfraglimitintermission_runningintermission_exittimeclanring_best_chase_targetclanring_current_chase_targetclanring_chase_delayclanring_best_cameraclanring_current_cameraclanring_camera_delayclanring_angleclanring_angle_xclanring_angle_yclanring_angle_zclanring_qdwepclanring_qdwep_xclanring_qdwep_yclanring_qdwep_zclanring_qdkillclanring_qdkill_xclanring_qdkill_yclanring_qdkill_zclanring_badstatsclanring_badstats_xclanring_badstats_yclanring_badstats_zclanring_othertargetclanring_inflictedclanring_chase_scoreclanring_did_damageoflagsclanring_cam_delayclanring_oldangleclanring_oldangle_xclanring_oldangle_yclanring_oldangle_zdelayed_impulsetimeslotnext_playernext_teamnext_cameraclanring_old_velocityclanring_old_velocity_xclanring_old_velocity_yclanring_old_velocity_zclanring_hack_counthealtyperotthinkclnetconnectionname15name15textname_readyoldnamemyiptrueipaddresstemp_ipplaglagchecklagcountwarp_menuwarp_episodewarp_maptimetojumptimetojump2hook_outflag_carrierlast_hurt_carrierlast_flag_capturelast_capture_teamflag_sincelast_returned_flaglast_fragged_carrierlastteamupdatefdefensesfreturnsfpickupsfdropsfcapturesfcdefensesfcassistsfcfragstrue_killsdmg_takendmg_givencaptimeweapon3_timeweapon4_timeweapon5_timeweapon6_timeweapon7_timeweapon8_timesys_ticratesv_frictionid_timekilledmodelindex_headprevious_weaponteamscr1teamscr2laststattimelastteamscrtimerunespawnitems2rune_notice_timeplayer_flagregen_timeregeneration_soundhaste_soundhookdmgclanring_kick_modesys_readyctimeclanring_version_redhookentityhook2intermission_posbanlistbanentchase_activehookspeedfirehookspeedpullalphaping_timecheaterhack_timeoutclanring_afk_checkclanring_afk_timeoutafk_timeSV_ACTIVESV_PAUSEDSV_LOADGAMESV_TIMESV_LASTCHECKCL_ACTIVECL_SPAWNEDCL_DROPASAPCL_PRIVILEGEDCL_SENDSIGNONCL_SPAM_TIMEQS_ADDRQS_IN_ADDRQS_ADDRESSQS_MODQS_CLIENT_PORTPR_EDICT_SIZENOALIGNBIG_ENDIANB546L542B542L546B457L463PSTRING_TO_PQUAKECPQUAKEC_TO_PSTRINGPC_TO_PQUAKECPC_TO_PSTRINGPQUAKEC_TO_PCPSTRING_TO_PCprogssvHUNK_IPLOGHUNK_CONTEXTHUNK_CONTEXT_MAXHUNK_ZONElasthcurrhALLOCATE_HUNKALLOCATE_HUNK_NEXTLAST_TIME_UPDATEarray_user_map0array_user_map1array_user_map2array_user_map3array_user_map4array_user_map5array_user_map6array_user_map7array_user_map8array_user_map9array_kick1array_kick2array_kick3array_kick4array_kick5array_kick6array_kick7array_kick8array_kick9array_kick10array_kick11array_kick12array_kick13array_kick14array_kick15clanring_passwordclanring_password1clanring_password2clanring_password3clanring_password4clanring_password5clanring_password6clanring_password7clanring_password8clanring_password9clanring_pass_maxCLANRING_MAX_SUICIDESUSER_MOTD1_1USER_MOTD2_1USER_MOTD3_1USER_MOTD4_1USER_MOTD5_1USER_MOTD1_2USER_MOTD2_2USER_MOTD3_2USER_MOTD4_2USER_MOTD5_2USER_MOTD1_3USER_MOTD2_3USER_MOTD3_3USER_MOTD4_3USER_MOTD5_3USER_MOTD1_4USER_MOTD2_4USER_MOTD3_4USER_MOTD4_4USER_MOTD5_4USER_MOTD1_5USER_MOTD2_5USER_MOTD3_5USER_MOTD4_5USER_MOTD5_5USER_MOTD1_6USER_MOTD2_6USER_MOTD3_6USER_MOTD4_6USER_MOTD5_6NUM_USER_MOTD_LINESQSMACK1QSMACK2QSMACK3QSMACK4QSMACK5centerprint4centerprint5centerprint7sprint2sprint3sprint4sprint5sprint6sprint7bprint2bprint3bprint4bprint5bprint6bprint7motd_top1motd_top2clanring_qtag_itplayer_stand1player_hook1player_hook3request_mapnamerequest_timelimitrequest_overtimerequest_gibsrequest_modehealamountconsole_originconsole_origin_xconsole_origin_yconsole_origin_zoldenemyplayer_runplayer_hook4s_explode1s_explode2s_explode3s_explode4s_explode5s_explode6multi_entmulti_damageplayer_axe1player_axeb1player_axec1player_axed1player_shot1player_nail1player_light1player_rocket1lastspawnteam1_lastspawnteam2_lastspawndmgtimeplayer_shot2player_shot3player_shot4player_shot5player_shot6player_axe2player_axe3player_axe4player_axeb2player_axeb3player_axeb4player_axec2player_axec3player_axec4player_axed2player_axed3player_axed4player_hook5player_hook2player_nail2player_light2player_rocket2player_rocket3player_rocket4player_rocket5player_rocket6player_pain1player_pain2player_pain3player_pain4player_pain5player_pain6player_axpain1player_axpain2player_axpain3player_axpain4player_axpain5player_axpain6player_diea1player_dieb1player_diec1player_died1player_diee1player_die_ax1player_diea2player_diea3player_diea4player_diea5player_diea6player_diea7player_diea8player_diea9player_diea10player_diea11player_dieb2player_dieb3player_dieb4player_dieb5player_dieb6player_dieb7player_dieb8player_dieb9player_diec2player_diec3player_diec4player_diec5player_diec6player_diec7player_diec8player_diec9player_diec10player_diec11player_diec12player_diec13player_diec14player_diec15player_died2player_died3player_died4player_died5player_died6player_died7player_died8player_died9player_diee2player_diee3player_diee4player_diee5player_diee6player_diee7player_diee8player_diee9player_die_ax2player_die_ax3player_die_ax4player_die_ax5player_die_ax6player_die_ax7player_die_ax8player_die_ax9last_teleport!444445%%%4424!= 244!=4! 6%%%%%%2%%+%% % %% %      2     2%%+%%%2%%+555%5%5%%%#%$%2&4'()=*4('+54"5!!,4""5544!-5".>,/>/?214234567=849:3;<6B5">"=?5E@5FF0E%0FGE%GEHD%HEID%IMNP4LO2'L4C ?@J,MQL N?Q>J2MMLN=2M @S2NM4T@ U 7N45MLN @V2+OLL5L=+Z5[>\5">]YYR2R@>Y 2;Y>^=>5Y5 ^21[_Y>%_[`Y>%`bZ 6>Y5"= Zc2Y%d5= ZS2Y%d5= Ze2Y%d5=4Kf4%4g5"=3W+YY=l5kim5i%njja2a i%% p2jji5i=i5iiok%o35uu5!s9qsv5'q9s5s5!tx9  70ts5u4h8't+{{2z{  2{+{{=|4+~5w2w 5  2+5=4+24,?24?24+ 45"5424 2= 2= 2=2%=2 5%=%5+4}4+24}1! 24}1! 1+ 45"1+ 2525"55+1+ =244}14+ 2+45"1+ 55"4!242+5" 5+4}14+ 4}45"1+ 52 2425"255"2 2422555!55+244} 2+=&24! 6!25+=5+=22 6+= 6++ 2  2+=+2  2+=+2 2+=+ 2 2+=+2=+%n5m54}2!%% ,>2= p21=4!25!5=5224422+%n5m54}2%%42+45=5+1+B55"5+5"14++5"14++14+ 5+5"4+14+ 44!.2 4+ 52 % =5+ 5"5+14+ 4!.24+ 5424 2= 2= 2= 2 %=245"5%45"55+5"!! 5+#$5"(1()4+(%%(%&(%'+,5".1./4+.%-1024+0515455"77659:5"=1=A4+<4@;5?>>@2=>B?>%B>>=1EH4+G2I4+FG 6!FE5F51KQ4+L4}NMN2NMM4P1PKLM 6D+L5OM2MMM4MM M2M= M2M= M2M=MNNPC2CKNRON%RNN=2MM4MKM5"KOM5OKNSON%SM4MKM5"KOM5OVW5"ZZXY 6J5^[4^^+^3]`` 6*[b4ffi4eei4dei4ffdi4eec2d d4!hgch5d2cc= dj2cc=dk2cc=dl2ccgcm5cce2gc5cce4!hgch5e2cc=ccgcm5ccf2gc5ccf4!hgch5+g1+ 3o1o+t= o2+u= o2+v= o2+wo4ppoop4qo4ppoop4qqq4pp4!soros5oorox5oopqqq4!sros5ooro5+r 2!y=$ 2!z= 2!{= 2!|= 2!}= 2!~= 2!= 2!= 2!= 2! 2+y 2+z 2+{ 2+| 2+} 2+~ 2+ 2+ 2+ 2+=+ 2"=8 2"=4 2"=0 2"=, 2"=( 2"=$ 2"= 2"= 2"= 2"= 2"=  2"=  2"=  2"=  2" 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+  2+  2+  2+  2+ 2=$ 2= 2= 2= 2= 2= 2= 2= 2= 22 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+=+!42!4!4!4!4!45555555555!4!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! 2+ 2+ 2+ 2+  2+  2+  2+  2+  2+ 2+ 2+  2+  2+  2+  2+ 2+ 2+ 2++ 2+ 2+ 2+ 2+ 2+ 2+  2+! 2+" 2+# 2+$+% '2+( '2+) '2+* '2++ '2+, '2+- '2+. '2+/ '2+0 '2+1 '2+2 ' 2+3 '2+4 '2+5 '2+6+%8@2+98j2/82+:82+;82+<82+=82+>8?2+@8A2+B8i2+C8D2+E8F2+G8H2+I+J=*8K2+L8F2+M8N2+O8P2+Q8R2+S8T2+U8V2+W8X2+Y8Z2+[8\2+]+_@2+`_@2+a_@2+b+cej2se2+e2+fe2+ge2+he2+ie2+je2+ke2+le2+me2+ne2+e 2+e2+e2+e2+eo2+pe?2+qer2+qeA2+set2+uei2+vew2+xeD2+yez2+{eF2+|e}2+~eH2+e2++J=we\2Oe2+eK2+Le2+eF2+Me2+eN2+Oe2+eP2+Qe2+QeR2+Se2+eT2+Ue2+eV2+We2+eX2+Ye2+eZ2+[e2++]=&e2+e2+e2+e2+e2+e2+e2+e2+e2++@2+ 2+ )2+ 2++@2@2P@2' 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++=& 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++=O@2' 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++=& 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++=@2P@2' 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++=& 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++=O@2' 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++=& 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++2jw2822+2+2+ 2+2+2++ =o2+ ?2+ r2+ A2+ t2+i2++=/2D2+z2+F2+}2+H2++=j2+2+K2+2+F2++=i28T2N2+2+P2+2+ R2+!2+"+#=2+$V2+%2+&X2+'2+(Z2+)+*=/2\2++2+,2+-2+.2+/+0=2+12+22+32+452+6+7 92+: 92+; 92+< 92+= 92+> 92+? 92+@ 92+A 92+B 92+C 92+D 9 2+E 9 2+F+G I2+J I2+K I2+L I2+M I2+N I2+O I2+P I2+Q I2+R I2+S I2+T I 2+U I 2+V+W Y2+Z Y2+[ Y2+\ Y2+] Y2+^ Y2+_ Y2+` Y2+a Y2+b Y2+c Y2+d Y 2+e Y 2+f+g i2+j i2+k i2+l i2+m i2+n i2+o i2+p i2+q i2+r i2+s i2+t i 2+u i 2+v+w y2+z y2+{ y2+| y2+} y2+~ y2+ y2+ y2+ y2+ y2+ y2+ y 2+ y 2++g 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2+  2+  2++2 2++2 2+  2+  2+  2+  2+ 2+  2+ 2++2 2+ 2+ 2+ 2+ 2+ 2+ 2++?2 2+ 2+ 2+ 2+ o2+ 2+ 2++A2 2+ 2+ 2+ 2+ r2+ 2+ 2+ 2++i2 2+ 2+ 2+ 2+ t2+ 2+ 2+ 2++D2 2+ 2+ 2+ 2+ w2+ 2+ 2+ 2+ 2++F2 2+ 2+ 2+ 2+ z2+ 2+ 2+ 2+ 2++H2 2+ 2+ 2+ 2+ }2+ 2+ 2+ 2+ 2++2 2+ 2+ 2+ 2+ 2+ .2+ 2+  2+   2+  j2+ +K2 2+ 2+ 2+ 2+ 2+ 2+ 2+ 2++2K4!++ 2@1+ +! 2+" 2+#+$ &2@1+'+( &2+) &2+*++ -2++.0q@2+10q@2+20q@2+30q@2+4+5I4J4L4M4N4P4Q4R4S4U4V4W4X4Y4[4\4]4^4_4`4b4c4d4e4f4g4h4ji5Hjkl 6Kjmn o 7Ojpq r s8Tjuv w xy9Zj{| } ~:aj  :a4j  :a5H 6/5B  70 6C  8t  7D  9z  8E  :  9F  ;  :G 6"2+@T+@>T@>2 6< 6"= 6"2+@+@>@>2  7= 6"= 6"2+@+@>@>2  8> 6"= 6"2+@+@>@>2  9? 6"= 6"2+@+@>@>2   :@ 6"=+@2"Q 555+@2 "Q 555+@25+@2@1!65'665'651++@@,@,>>2!=2!=!65'665'651++@23+!65'665'6524-+ 24= 6Ki4ii44!5m54!255i4ii4iij44!255m54!255m54!255 4  24 4!  4 i4 ii4 iij44m44m444i4ii44!244m44!244m44!244i4ii4iij44!244m44!244x44!244 4!!!5B#4!$$ 6<&4) &)2&4"+)4!((x 6<&)&*2'**''=*&4&2**4*&*4))*&&1&*)4!((5=5,4--2 -/205=-1225= -j225-225-4!..54455j465j476j552664!8=!2885546655?76264!8=!288554!88524:+:<4==l4>=l4?!2@2>>4!@=<l2!@>l==@5=k4>=k4?!2@2>>4!@=<k2!@>k==@5=j4>=j4?!2@2>>4!@=<j2!@>j==@5=4>!2@??>2>4!@=<2!@>==@5=4!@@5B4CCl4DCl4E!2F2DD4!F=Bl2!FDlCCF4Ck4DCk4E!2F2DD4!F=Bk2!FDkCCF4Cj4DCj4E!2F2DD4!F=Bj2!FDjCCF4C4D!2F?ED2D4!F=B2!FDCCF4D4!FF4H4II2 I/204=I1224= Ij224I224I4!JJ4 L4!OO 6<2Qf5=51SU5+TT2 @ST2T2@ST4PTT=TT=5X5Wi4KY5W4KZ5W4K[5W4K\5W^4K]5Wb4K_`2+_+`bc2+b+cef2eh=fhhg2+h+gjk2jm=kmml2+m+l3"qq'rq(qp%q*o+qv4!wuw5"{z 6"23yz 6"="{}~5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x}5x5x5x5x5x5x5x5x" 6"2 +@23 6"="4545t+ii  7>OP2+ F2++"NFNsF>s2 Nii N 7>OP2= F2+i G4\2++@2 @% 6<= A% 6<+@2 +++@% 6<= ++A% 6<@2@5=A55t 6"2 25+ 6"=@2=@2@2@2+@2=+  ?2+=> 22+=: 2+=6 2+=2 2+=. 2+=* 2+=& 2+=" 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+=+"2w 2+"=+2= 22==+ 3}3}3}+5@ 54@5@55555 52 2"Q = 2 5 5 5 5 5  5 2 2" Q =  5 5 5 @ 5  5  5  2 =" Q  5 5 5  5  5  5555 5  2  2     k2   k    = 4  2 = k2  + 555"    2  4"    2 = 2   > 2     2   5  =5 5!  ! l 2 +@24+%+ +A%  ? ! @?! 2 +" +# +@# %" 4+l2   6$ G%$ l% l%% = +& +' +@' %& 4@2+ 5n"* * l%* b%* m%2. . + ( 2( . ,  6". . =0 4-1 4+@1++/ +3 +@3 %/ 3 A 7 D 5< 6 5E 5> %n: : 4 24 <> 5> > %% F  H ?F 2: =, p2= = ; = 2@ 47 = = 2@ 48 = = 2@ 49 =; 2 4!? 2? @ ; ? 5; ; = = G ; >G 2@ 49 : : : => 5> 7 I 8 ?I J 9 ?J K 7 ?K L 8 ?L M 9 ?M 2++7 P 2+S S + N 2N S , 5 T T P 2 U Q W U ?W 2 U 2+S V R X V ?X 2+S S S =+` 5[ [ + Y 2Y %[ , 5 \ \ 2\ 4!_ _ 5x5] 4!_ _ 5x5^ 4!_ _ 5b 5[ [ = d 4O g g 2h 5+g ,  6"i 4j 5+l 45 p p 2t 4-+ p 4O 2u 4-+s s + a 2a s , 5 m m 2 s ,  p 6"w l  6/+s s =x 4-+1+;l5!z z 4k 2w z  6/={ 4-! ;1+} 4! ; 2 x5!~ !~ ;= !;~ ~  5!~ ~ x5!~ !~ ;v v       2 ?  3  2   @*2@2  \   @>%2" 2  =@2  @2  @+2 @2 @2 @2 A H2 \   > 2  ii 4     > 2  i i 4    %   ? 2"  ? 2"_( l%!     > 2!  5 2 l l %    2i  i 45  2     _ 2_(  ! = % % _ 2 _( 2" 2"= l2   ? 2"  2 _2_5  2" "%3 " 1+# 2  52 G 3} % = 2 G 3} % = % # = A% 3  A% 3 4 2+1+1"+ ? 2+32+ 2     > 2+  j2+"41+ 2+1"+ 2 2+ _? 232+ 2     > 2+  j2+=" 2+ _  _ ? 2    j2+ _32+" 5 6" 2  +@  +@,> 2 4!  2  8> 4!   6<  6" = 5 6" 2  4!  2 6<  6" =5 55@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 55@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 5@2 55 54" 54" 54" 54" 54" 54"4  4!   8> 544!    7=44!   6< 544!    7=44!   6< 544!    7=44!   6< 544!    7=44!   6< 54 54" 54" 54" 54" _1_(  _  7=5_+@2 5_+@2 5_@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_+@2 5_@2 5_@2 5_@2 5_@2 5_@2 5_@2 5_@2 5_@2 5_@2! 5_+@2" 5_+@2# 552 _(*__  6( _2_% g % 2' _  7=+_& _ 6(& =) 5_(+ 5, 5- 5. 5/ 50 51 52 53 54 55 56 57 58 5!: 2: :  6<: !: =>,( ,%?( 2@ 5+"< 2< < HA 6<< 4"< l> < != 2> =  7== != > > =< "< =2C D 5=E 5G 4H G  6<H 4"3 J J 4!K K L 6<M 4F N 4F O 4F P 4F Q 4F R 4J S 5J 5%T 5 2U 5= 2V 5=4!K K 54,!K W K  7=4!K X K  7=Y 5@2E 5= @2Z 5=[ 5\ 5@4B ] 5@4B ^ 5@4B _ 5@4B ` 5@4B a 5@4B b 5@4B 4"d f d  7=e 2d e 4+e e g d  7=d 4"d =j 5k 5 6"i 2i *i +@2!i +@2i +@2l i  7==m i  7==i +@2n i  7==o i  7=i  6"i =q 5r 5s 5t 5u 5v 5w 5x 5y 5z 5{ 5| 5} 5~ 5 5 5 5 5 5+@,?  >? 2+ ?23 =c 23 =^ 23 =Y 2 5n=R 2 5*$ =I r23 =D 2 5n== 2 5n=6 2 5n=/  2 5n=( A23 =# 239 = 23; = 23I = 23c = t23h =  23p =  23* "  *@2 @2l2 @, ,%? 2   g ?  ! ? 2 2 H+@2! ="  4 4-  5  A% 3}  2  8~=+ 2  8~=" 2  8~= 2  8~= 2  8~=  8~=3}  2 5= 2 5=  2 5= 52    @ %  4 4-" 23 +@ + +A% 3 + + %  A%  2+ 6"23+@, +@> 2& 2$i  i  42" "   @ % " %/A@  3 A %*  %   5" + 6"= 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5! 5" 5 5 5 5 5$ 5% 5& 5' 5( 5) 5* 5+ 5 5 5 55- - 2- 4!. - 4!/ . D 22/ 2 . 9=- - = 550 5, > 2+g 2 A >2 2 4 5*A%@%=Wg 2A%3 =Pg 2A%3 =Ig 2A%3 =Bg 2A%3 =;g 2A%3 =4g 2A%3 =-g 2A%3 =&g 2A%3 =g 2A%3 =g 2A%3 =g 2A%3 = 5 5*A%@%*g 3 @ >3 2 4 5*@%A%+=lg 23 @%*1 =cg 23 @%*1 =Zg 23 @%*1 =Qg 23 @%*1 =Hg 23 @%*1 =?g 23 @%*1 =6g 23 @%*1 =-g 23 @%*1 =$g 23 @%*1 =g 23# @%*1 =g 23, @%*1 = 8 5*@%+29 55 5*@%A%+@2: 55 5*@%A%+@13 *6 A2A7 g%7 3 > = @ @ X2@ A @ =@ B 2@ A @ @ ? = + G D 4 J J M 2A J J J 2J =J J J N 2N J +J P 2v; P S %; =vT P S %T Q 2wU Q S %U =wV Q S %V R 2xW R S %W =xX R S %X P 2Y P S %Y =Z P S %Z P 2[ Q S %[ =\ Q S %\ R 2] R S %] =^ R S %^  u& %"g "f 3c "g k 6"j j _ j i >_ 2j k 6"j = j 23"j j (i j %j h%j g%j u` j u&` j p 5zj   6{j j i5yj 'k j l b%l j *d j Q5j 5i 'D q b%q 24+2+s 4s 4h D 5zq&Q554e 1v t b%t *r =4w b%w   +@,? 24u +224u +{  )  { ) ~ | ) 6<   ~ ~   ~ 4xix x >x   7F>m x m x x F; x   7Fj; x x x x   7F2 G x  x   7 F2 x i x 4  i x 4 i x   7 F2u u&   2q   & =  2q   & =q  &  x 5y ~ 4O 'D  2%=4h  24h 43"  ( g% h% D 5z   6{  i5y  %  *  +@  2 > 2   5 +  +  +@ %  % +@2v+ +@1v+2v+ +@2v+ % v2   5 4!    6K=' v2 b5nv+= v2   5 4!    6K= v2   5 4!    6K= 4v+" " 3Y" v! ! ! ! y3"3"~4' !(#(%33 3 3 3   2 5 =+% 4 4 4 4 4 4 4 4O 4%%4 @1@1@1AA@2 5nM 4i4 @13  f5 5 g5&AAAA5t   4 4 4""""""5k ""   5n!D @2 M 4 223 =@ @> 2 O f5N S5M 5@ @,> 2A3 ! ;3   4!  L 5. 5n 5n " 6/ 4- " 6K4 "2 6"2a 24 4- 6"=4 6" 6"4 " 6/ 4- " 6K4 " 6/ 4- " 6K4P 4 2P 5tM 4P 4N 4Q 4 4 4 4 4 4 4  5n  5n 5n@1 5n= @ @,> 2O g5!"4w 2 %%4!     8T 2N  5tN 44! @2@2   6K=   6K2%! 4=" 4=   # 6K@2$ 4=% 4"' +@2"' 4+(  ) 7=* 5+ 5, 5- 5. 5/ 50 51 52 53 54 55 56 57 58 59 5: 5; 5< 5= 5> 5? 5@ 5A 5B 5C 5D 5E 5F 5G 5H 5I 5J 5K 5L 5M 5N 5O 5P 5Q 5R 5S 5T 5U 5V 5W 5X 5Y 5Z 5[ 5\ 5] 5^ 5_ 5` 5a 5b 5c 5d 5e 5f 5g 5h 5i 5j 5k 5l 5m 5n 5o 5p 5q 5r 5s 5t 5u 5v 5w 5x 5y 5z 5{ 5| 5} 5~ 5 5 5 5 5+ +A% "'   % *  5 5 5*&  %  5 @2 6" 2   2   6" =2  5*  G% " @, @,? 2  8~42 5" 4 6<@2 2% 5= 5= @2 5= 54" + +AA%  5 5 5 5 5" 4"     !> 2  2+ ! 2+  ! =+3 2! !( !("     !> 2 2+ ! 2 ! !( !(+  ! =~2" "~ 494 44!    6K+@23Y" 4"~+@22D@2 5 5 52 5=3@2 5 5 52 5="@2 5 5 52 5=@2 5 5 52 51  A% 2 5%/@,  > > 23 2 > 2-@2! = @2! =@ @? 2!   62 284k 2w 82  8t  8~ b5n" 2  w  w 5  w 6 " =@42&3r1+845 4O 2"~  5n+3n!   63)  5n@444AA67AAA93 3  %  5n 5n@23 =3  5nb%(%f%e%(](*+%%%  % 3 % _(6' 4' 5' [ % %AAAAA@444+ + + AAAA@  % <%b%>%=% e%    AAAA@  % 6%5%7%8%%e%%7' @23 4 =3 4 4 2" 54" +@ @ +@,> ? 23 " 4g%f%+ +A% +@ @ +@,> ? 23  )5n=-2%@2 +@, +@,> 2 G5n+@2  2%  2%3 3 i5 u4xi4 @2   % + + +@ % w % %[ % e%m% 6< 5 5 5 5 5 5+@2 5 55 5 5 5 5 5 5 5 5@2  5 5 5 5 5 5 5 5 5 5 5 5 5 5 55 5 5 5 5 5 5 5 5 5 5! 5" 5# 5$ 5% 5& 5' 5( 5) 5* 5+ 5, 5- 5. 5/ 50 51 52 53 54 55 56 57 58 59 5: 5; 5< 5= 5+@2> 5? 5@ 5A 5B 5C 5D 5E 5F 5G 53 I 5K  6/=%M 5N 5O 5 Q 7=R 5S 5R 4U S 5U 5%@2 @2X 5=Y 5=@2 @2Z 5=[ 5=@2\ 5= 2%] 5=^ 5P 4W _ 5W 4"O 4W ` 5W 4"@1M 4W =W a 5W 4"N 4W b 5W 4"@22c 54"= 2d 5=e 5=  4W f 5W 4"g 5@2h 5=D 5i 5@2h 5=D 5j 5@2h 5=D 5@2k 5@2D 5=h 5l 5@2h 5=D 5@2m 55q  6"o 2o o +@ o +@> 2q o  6"o =1q s 5+t 5u 5 6"o 2o o +@r o +@>r 2 o (4!p p w o 9?o  6"o =+@,v +@,?v 23L ++z +{ +| A@| { %z y 2+} +A%} = y 2+~ +A%~  23 %+ 23 %+ 23 %+ 2+@13 %+ 23 %+  23 %+  23 %+  23 %+@1D2 5  @> 2   @ % %+=0  @> 2   @ % %+=  T @> 2   @ % %+=  @> 2   @ % %+, @,> 2@1 2{@23 %+  2 , {@,> 23 %+ D2+@1  53+ +A% %%+  22% 5%+ 22%3 = 2 4!    6/=  23J =  2= e% e%e = 2> >% >2>%<%=j2?  > 23 = i > 2i4x =Z23 =F  > 23 =P  > 23 =V  > 23 = j23 = 23 ={ 2 g%@%A%?%*3 =l 23V =g 23 =b 23 =] 23H =X 23 =S  23) =N K23n =I  2 5=B  23P ==  23T =8  2 5=1 X2+ +A% =)  2 5="  > 2+@2 v2 4 = v2 4 = +@2 4 =3 = 5%+@2+b b% b2 b2 5v4 +b44!    7=++@2+b b% b2 b2 5v4 +++@1++@1425b2b b % @2m2m m% +@23 3 =13 @2+@ @, @,> > 2+@23 4 % @, 2 > 2 2 i% <2 % 3   i4 +@2, 2v4 +3i 4! i 4,! i 2 i 2 5 55  W   9 5=  +@,> 2 %+ +A%  512w@1 2 2 2 43 +2MM 4iN 4O 4%4 6"  29 +@2# e2" Q5 5 e   e> 2  5 4 <% e2v 4 = +@1  '  h% % '  'D   6" =2i3  5n )5n3 2 2 4- D 2! D 2 4-=  6@,  4> 2 4@,>2?4  2 4=84 i2 4=14 2 4=*4 2 4=#4 2 4=4 2 4=4 2 4=4 2 4=4 2 43 R 4b 4  52  4 2+ g% h%@2 &  & = & &  m5y   6{   8~ u  I&  b% 2       A@  %  ( b%  % % %4  6"2*+@ >25=+@  >25=2 5= 2 5 6"=  8~ 6"  2  2     @%  4  6"  2  2    @% 4 14+ 25=5(i i & b%t% r%s%%h%g%@1uu!&@2  6{=   6{=%&2+ 6"(($(&>$2  6"(()(&>)2+&H%&*&+&,A@,+%*2'(4 =(2(4@2+h 2b 2m5y@2  6{=   6{+h 2 b 2  2a2=-%-@2+2+2++@2+@225+1 >12+3 32b 2H 2 255=65/0/2 740484[02[%049:A@:9%4JK@;@?;2\  8~5T<T%< 6"//2H/+@= >=2/?5= /+@>  >>2/A5/e%/@ @2$/C5/5/M2 /D5/5/VB/V%B/N2 /F5/5/VE/V%E=/H5/I%/ 6"/=H%3 ++ 2I5=J5@,G@?G2 5QKQ%KM%4+ 2M5=N5@L@,>L2P5@,O@?O2   8~RQR%QH%RSAS%RL%b 2/%=/%b%g%h%( 6"//2%/2/+@2 2/U5=  2/V5= /TT2/X5=/Y5/ 6"/=W?W2@2& & =&& 6{4@2+[b%[b 2h%+b 2 3Z@1=24+b2c4]]24+]u4x ;^`` ab?>b2Yd>d2% 2aa= 2aa= 2a a= 2aa=  2aa= 2aa=,oe?>e2$ o2aa= 2aa= 2aa=  2aa=   2aa= ?2aa=0f >f2(g>g2aa=h>h2aa=i*>i2aa= *j >j2aau]u&ul]ur&lio]ixua^ u{A{&oH 2  6{=   6{i5ykb%k 6" 6"+@,>2"""  >25+b >2  25=5 6<="  25=5 25=b 25= b 25=5b >2  25=5 6<="  25=5 25=b 25= b 25=5@13 H'%h%g%q&A%ll%*\*.b%b%I~u&~%%51 4i4444+mi&@14+%%(A%@2%45zH'444'''& &  6{="ll%45zH'%444' ''&& 6{'* %@14+% %(A%@245zH'%444'''& &  6{="ll%45zH'%444' ''&& 6{'* %u&g%h%5zn 6"n n2n 6"n n24+n@@,>2+2+2++@2+  >2+q@ 25+qqqA%q@2 ooA%5=#q@2 ooA%5=q@2 ooA%5= q@2 ooA%5%R  8~4"3"q443"(ii &q%t%r3}k%s3}k%%h%g%@25z=@25z= @25z=@25z   6{*F%*'q@2 ooo@%4=&q@2 ooo@%4=q@2 ooo@%4=q@2 ooo@%r%4qqq@ %"3}23"=3"43"43"43"443"G%*@14+ 5x34+@2+@1+q@  2+3"(4xi5yqk5&qq5&%h%g%q@2 q%5zooo@%=/q@2 ooo@%q%5z= q@2 q%5zooo@%=q@2q%5zooo@%%j   6{*F%*qqq@ %'I&O&W&S&& & &Y%Z%%R%T%P%Q%V%W%[% X%e%I&o&W&S&O&@,,%?25+555555! 2 = X  Y  Z Q      25 4+5  55  55=5 4+5  55  55  6< ! =A@>%2= 5!5"5#5$5%55&5'5!"2< 2 (5 4+)5= 25 4+*5  5+54++54++54++  7=!">2 25X43,H  7="=./505152535455556575!--2:.2=7 -2 (5-4+)5= 25-4+*5-X4++5-J4++5-K4++5-L4++5-Y4;+5-Z4;+-  7=-!-..=29j894::225:4!;;5:j2<5==5A5B5C5D5E55F5G5 6">2>I>+@1@>X>T5+5>Y>U5+5>Q>P5+5>Z>V5+5>T>UH>VHI>PI?>XJ>YJK>ZKL>QL@ >2 (5@?5)5= 25@?5*5> 6<> 6">=A@>%2Q=QR5S5T5U5V5W5X5Y5Z5[5\5]5!OO"P2O\O+@1J O2 (5OR4+)5= 25OR4+*5OT4++5OP4++5OQ4++5OU4++5OV4++5OW4++5O[5 O2 ^5O585= _5O55O!OO"P>Q2 5,PH  7=O"P=5@>%2e=eg5h5i552ej5k5=l5m5!``2A2e`w4h!ff* 6<`Xc`Lcd`TM`UMn`Vno`Pob`Xp`Ypq`Zqr`Qra `2(5cd5t5ab5)5=25cd55ab5*5` 6<`!`=+5v225v4!yyz 6<w225w4!yyz 6<x225x4!yy5@>%15+"15+@s+@,>s25+5"|2| |w4h!}+} 6<|"|=5"|2|5|"|=5"|2||W4u|"|=5"|2||S4u|"|=5"|2||o4u|"|=5"|2||O4u|"|=5"|2|"+5|K4!}|K225} 2 7=|L4!}|L225} 2 7=|"|=5"|2|#|Jjb4~~4!}} 6<|J~4~~4!}x} 2 7=225|"|=5+@2*5553 5@13 5@ %>23 53 53 5 %23{@23N555555555 V23 =* 23 =% 23 =  23 = 23 = 23{= 23N=  25=  231%+ 6"2+@,>2   2 2 6"=2$4!  25=5 6<4! 25=5 6<+2$4! 25=5 6<4!  25=5 6<+ 2 4!  7= 6"2+@,>2   2 2 6"=254!  7=4!  7=+254!  7=4!  7=+ 2 4!5  7=+@2"+@2 65%w%=+@2   65% w% 6"22+@2=+@2 6"= >?2= >?2= 2=   2=3}4 2' 25=5% ++A%w%5+@23= %e%_(3 33X=&  25=5%++A%w%5+@23= %e%_(3 33X"3"4+@233!""!%23=44-"""22""=2""=2w4!=! 2+%2' 2 2w4!==2" 22= 2!=""w4!= 22=  2!=3= 23m2*%>%2G5n""( 555 555 555 55@25=Im25=B@2"ml2 45554555=l4!5555K5 5555 6"Q2QQ+@2Q+@2 Q  2Q 4=D 5Q 6"Q=41+G5n"% 6"Q2Q)Q+@2 Q+@2""!>2"!"H5"!"5=Q  2Q 4Q 6"Q=41+G5n"   % % "! > 2 " "( = "(+@2+@2+A@1+"Q+ +A%  % 6"2.+@2+@?%A@,?2D 5  +@>2 %=  2  % 5 /5 6"=  2(32  %5/5=%2 6"2"!2 %/5"= 6"=  23+A@>%2"2l2 !H5!5"= 4+@1+"Q++% D 5 6"2+@2 55 6"= 6"Q2QQ+@2 Q+@2"!"5Q 6"Q=41+ 6"Q2QQ+@2Q+@2Q 4Q 6"Q=" 6"2+@2+@233 6"=" 6"2+@+@>@>2  555 6"= 6""2""+@"+@>#"@>#2"!5" 6""=&' 6&'  70)*+  7)* + 8t-./ 0 8-. / 09z234 5 6923 4 56:98: 6(;4 _2+"=2==2=$=l $2 => >2=47_(=+="==@>%2-A"?A"%?B%BA" C>C2AE5%F4=A"D D2A"l2 A"lGA" G2A"47_HA"(H@>%2!K"IK"%IL%LK"M_ M2 _(9K"O 6(P4= K",N>N23<^54  70 2+1b%l%=  2 bQb%QlXl%X=l%@>%2 wYw Y2bZb%Z=b%=b%(w[w%[b2l2lW!D UV=bW!]U"VW4!SW2!^T= W2!_T=!`TSTa U V81on]\ 6(\ 6"l2lilplp 4mmn2mn](ll 6"l=]l2lNvlll 6dx%v"Q55z5{5|5]~1~+aw~ewe~a>2/is~^~b s 4N2"~ 6"~1~+~I4x~i;4y~i5yu~I&%q; &@2@%AAAAA@%(@2 p 5z' "Q5533A%g%f%@%&+@25=555+@1533A%g%f%&A%%555+@15_1_4c(_153+\%=_ _?2_4c(_153+\%33A%g%f%&_i5y_2i_i5C =u 4O 3d55@2 5%A%=5+@155_/_?2_4b(_153+\%33A%g%f%&3e55@2 5%A%=5@25+@155_/_?2_4b(_153+\%3A%g%f%&"Q5_5 5z3f55+@155%*++A%%@24k4 =3 !(33 24-23 =+++@%+@15%{{{@%+++A@%%%h%8%6%5%7%?%;%9%=%%% %%%%%%%%/B%]%' H' '    6{&%*3 [%\%m%5w%@23@23=#@2 @2A%3 =@2G%*=@2 @2A%3 =3+@254 +@1++++@%%e%355+@25@153 _(3 33X 6" 2 6"1  6" 2 6"+_4c"__4c(i5y_2i_i5C =u 4O \%_4c" 2"_(2_(4c"=_i5y_2i_i5C =u 4O \%+@?+@,?2" 6"/+@?+@,?>2 6"=+__4b(\%@_>2 "Q5_53f_13+_+@?+@,?24b"_4b(4b"2_(4b"=\%@_>2 "Q5_53f ;   7F2N N+@>N>2 _N2_(N\%m%++_2_ii 4    X2 A  4   2m%+i 4x 42+   4x 42+   4x 42+_m>2_(\% 6"2 +@_ >2""3_1A@253=@23" 6"= 2" 2" 2 6" 2" 6"2_ _+@>2""_(3 " 6"=2_(="/_?2_ _ ?2_(= _ 2_(2(+@+@,? !_ !? 2(="_ ">%2(=_51(=2(1#!1!#!(#!$_ $2!%!!(%!2&_&',%?'( >(2_52(!)!()@2@2 2 _>2_(\%21=_.@*@>*2 32_ii5C .8)89.)91/) 6< 23 14x_i+ +A>+ _ 7F?> + + +F; + _ 7Fj;; +;+ +5y2+ 14O _i5y2+u>_&>A_&A%_G@2#2:_>:2_("G\%  M ?M2i5yG_2GiG_i5C H=GuH H4O =4G  N ?N2.OG>O2G_(= G_2GG_51G_(G_1G_(!K2KGK52KPG_P2G_(KK!K=G_ 2G_(=Q%QG 23e+2+G_2GG_5L2LGiG_i5C H= GRGb%RGiG_i5C H=GuHS)STH)THI) 6< IJ H4O V5W5X5Y5Z5[5\5]5^5_5`5a5b5c5e5f5g5h5j5k5l5h5n5o5p5q5r5s5t5u5t5h5w5o5x5y5r5`5h5+@2 +U+{+@{%U}54+@2+5+|+A%|z5n+++@%23 =}5@2++@2> 23=8 23=3 23 =. 25=' 23g=" 23= R25= 25= 23 =  23 = 23 =^P> ?>?2FP2;3 2A%=2 2A%=* 2A%=" 2A%= 2AA%= 2A%=  2AA%@@@23~=3 = >25 23d= 23i=  23m= 23v@2+2  2t%=t%j+@,,?2+@%t%M ?2   6{@>%2!4!j2!D =2!2= 2!=2!2=!D =!D !D !\%@+A@?2+_   ?>2_1@2  88=25++@24!4!47!4!4!  ;;=@>_ >2=!D   ;;_  _ ?2__=_1  2+% %%%%%%%B%%' o%+%q@ 2#o%q@2ooA%=q@2ooA%=q@2ooA%=q@2ooA%=o%%%%%%BB%%@2'%???2 5=' %%2%k   7F    7F2+2=2   7F    7F2+2=2   7F    7F2+2=2 5y+i ;  7 F23%+=3 2+;j;2 4>2 2; 42+==2\=24xqD2;2A&Dtt%q4 2qq &23=3%2@2 @%== A%  AA@ 22_ 223=3=23=3 % =!@ ,> 2 23j24g%f%= %3 A% g%f%3}3h1#@23e= @23f=@23d@2 @%O5yqS&3\232#e%26 1 >2>2  2%=%>23 le A@ ?2+5^?Oq&S"q&"R%O%O(O4(+&+%O.i1O1&.O42!A%!+@2+7+8+@8%7:55= +9+A%9<55\%2E5++@;@>;2G5+3"'H-**=*D&'B''Cl%(@43A13=++F+I+@I%F+@23>++@2L5+2M5+J+A%J3A23>+@23?+M53@QSR 6"P2PP+@NP+@,>N2P+@2SS=RRP 6"P=>RS2jRSTTj2jT=jT 6"P2PP+@VP+@,>V2P+@2TU=jUP+@W P?W2QUQ=QUQP 6"P=Q2++Y& ' 8EZ4[  8~X%Xl\l%\l 2*?34"^4[  8~-34"1_5+ 23K=  23O"(_(%O 42!9!j=!D !l4@16@2+m44!k2n4k42o4p424!k2n4k42o4=44= 4!kkq r 7O=@14!kks5H= m2t4=m4!kk5H%+]+w+@w%]e%3 3+x+z+@z%x3@@u4|}5xy4 5x2%~4 24 6 M 5tM 4i3 +@253=+@13 =3%/3 %* {%{@2%3 =4(4!4,!  924!4,!  9m24=m4!m 6Cm 6/l4!l244-5B5HA@1@2l4!l4,!  9?=  7=+@25=m25=m4! m 7=l4!l25 6<24!4,!  ;A24!4,!  ;A@23h@*|% 2# >2im%l%3 244!5*a%3a=43+= @15+3d@@AA43 3 24= 63f*%_(343gM 5tM 4i4ll%l2l% mm%@1ml 6 %3_2_J_J%bb%m2l2+m2m4!3  6mm4 23=3 43=,l 2424!5=24=l2l 24l4!l4,!  7l 2*H''H 2H'5x41%+"2l"=+1%+"2l5a"=+(@3 A44@25x@2334!2%  74!5*a%m%l%3 %b%5x5x325x5n334424!44!5Bb%l%(w%ll%l2l% mm%%ml 6 3lP 234lQ 2;`4|5x5x4AA@24-@244 5x@244 5x@244 5xAA@244l 243=1lR 234!2%  7l 243=l2l 243 3 Al4!l4,!  7l 2*2% "2 """(w44="(!(@2 >255+=25+@2@33"25w%"2Mww 2G@l >255+ll%l2 !!!(!!(=!!(!(!("( 6 24w 2 ++A%@2%= w  2 ++A%@2%+"=24!  7="2 w4!  8>"=+3"'""("(!!(!(!("(l%ww%w 2 ++A%@2%= w  2 ++A%@2%%w48'Hw4H'%45 6ww5 24+ 6"2+A@,+@>2+ 6"=+@2+3"'* % A3 @2O& l%4=O&l% 43 6" l> 2 6"=+l4!5555l44!55l4!55243} 4423} 4=3(' (%w!w%!l%n%g%f%3#5@1%5++@2&5+'5l%*bg2+l"l)g)%"l1+l2+5=l4"(1(,5= ( (2(- 6<=(4e**.w%*3153++3+4.+A4A%335.%5O4.O&4S7.S&7W:.W&:I=.I&=@.&@ C. &C F. &F(6.(%6XL.X%LpM.p%MqN.q%NrO.r%OuP.u%PvQ.v%Q[R.[%RYS.Y%SZT.Z%TRU.R%UTV.T%VPW.P%WQX.Q%XVY.V%YWZ.W%Z[[.[%[e\.e%\.n2.i5y].%]^.%^uI.u&I_.%_c.%c$`.$&`}e.}&ed. %dk.*kl.%lm.%mn.%no.%op.%pq.'qr.%rs.%st.%tu.%uv.%vw.%wx.%x2y.2%y3z.3%z4{.4%{E|.E%|5}.5%}6~.6%~7.7%8.8%9.9%;.;%=.=%?.?%B.B%C.C%D.D%F.F%%g%f%62]%~ 6"1211, 1 .>21(1~ 6"1=@24@.n%(..(w4!/5/5534!/4,!0/  081% 2""=2"+++@%@,?@?,%?2+"222 2l"l2+2"2=D c 6 @25++@25+b25+3153+@15%++A%@,>3>23 333"!2!1+=!!(2%"! 2"!!("2"l"l%@@>,>24J=""(""2"=""(w44@25++@15+@255++++@%@25%354(K 5L 54k"l,>%2"4 2 6=1 6@244 6 @@3 344@15+ 25++@23=+@2D  6 23K=55344!2%5=5@15+3 25++@23=+@2D  6 23K=55555555555555555321  7== 5 2  7==5 6"2+A@,+@>22  7= 6"= 2+ %$hq&hq& 2g%+@?2$&+g%f%$q&q& 2+ %5555555555%*@,@?2+A4|}5x445x44433c*b%3@15+@25++@23=D  6 23K 2+ %q$& 2g%  ?2==%7277%6266%5255%8288%EE%44%+@?2+//%II%g%f%q$& 2+ %n%@1+@@4|}5x445x44  5x 433 b%  c* 525l2l4!25 % ll%=@3d4@2+A5n"l%44@2+@1"@25+21  7==  7=++@23 =D   6 23K+@15++@23c=D c 6 23K1%5++@1+@15+25!2 @2 6<!==5@2+  23@1 F2+@2 3 2+2%3=3=!5=5+ F@>23=7 23=2 #23=- $23=( %23=# 23= &23$= 23= N23= '23=  (23= )23@12%3++@1w%%++@1w"%"@2 2  65+w,@>,2w4x!+.+ 6+w4!+5+55-w%-@205=1524 2+@124k2+@1 @1@12323 +2+/2+42+@4%/@2f164-=9+@165%5OO&S8S&8W;W&;I>I&> A &A D &D(7(%7+J+KAAA@K%JXLX%LpMp%MqNq%NrOr%OuPu%PvQv%Q[R[%RYSY%SZTZ%TG&GRUR%UTYT%YPZP%ZQ[Q%[V\V%\W]W%][^[%^@2 3`4a4-b4A3@_ >_2n%c%cd%diVi&Vufu&fe%el%l$i$&i}n}&nm %mt*tu%uvwxA@xw%vy%yz%z{%{|'|}%}~%~%%%%%22%33%44%EE%55%66%77%88%99%;;%==%??%BB%CC%DD%FF%~ 6"3233, 3 >23(3~ 6"3=+@224=4-K 5L 5(,%  ?>2331 3d3|3443 3+= %2"l >22"4@2+24=4-(K 5L 5@>2 644@@3 1 6 >  ?>2tt%i l    7aI2 4! 6C4++"555 555555555555555555555555555555555"4@1#A 6"2+@2 2""3 "%{{{@% 6"=4=@2@45t2E5++@23+@1!!=@2!! 6 23K@2+M 5t 2&4=4*29 5+@2: 5+@A4!@%A% D 2 5@%A%++@2!@%A%3= 6 2!3Kl%* %A%@1A%%j%%%%%%%'%AAAAAAAA%@1A%%j%\%j%\%j%j%%'%@2+AA@+@,pM 4?2 2 M 5t@1O 54A= 2M 5O 5 2 M 5O 5A4=! 2A4M 5t+@1 @2O f5=O g5= 2 M 5tO 54A4! 65t"42 24-=9 5+4!3 +@,>2 2L 6/= L 7=+4%!@2 24-=5++@23=@15= @>2 5=  6 23K@1A=@5t"4@2 2 4-= 5++@23 =@2  6 23K=  6 23K@25+@2 4! 63 = iM 5t4! 6/@25++@23= 4&! 6 23Kgg>2g4=5*@15+@25+5 5!5"5*@2&5+ 2'4= 2(4= 4!$4,!%)$W % 7 5t+4+@2&5++@2+3#= +2 -D # 6 2+3K=+2!.,=+4&!,/,# 6 2+3Kg2g4*=g 24*= g 24*=5*@15+@2&5+2535455565*0A@ 2A84= 2A94=:45t@2 <2 2>4-=>5+=@2 <2 2?4-=@5+= <2 2A4-=B5++@2<37= <2!C== <2!D==!E=F=7 6 2<3K' h%%G@2 `5xI4@= 5xJ4A5t+@2 @2M5+3H= @2!NL=!OLLPH 6 23K 23Q29 5+@2T5++@23R= U5!VSSWR 6 23K@2`5xY4= 5xZ4A5t+@2 @2]5+3X= @2!N\=!O\\^X 6 23K@2 `5x`4@= 5xa4A5t+@2 @2d5+3_= @2!Nc=!Occe_ 6 23Kg5+@2g5= @2!Oi=!Niijf 6 23Kl5+@2l5= @2!On=!Nnnok 6 23K@245xq4@5t=3r4A5t+@23p= @1!Ns=!Osstp 6 23Kv5+@23u= @2!Ow=!Nwwxu 6 23K5555555 555555555555(4!++A%*5  7( @>22%53g2+llg%lk22 l4 2(%3+=l 25*((%(25v4 =5k2 555++@25+++@%2%+5l%*55 6"2+@+@,>29  8> 6"=55 24"2 4!2 2 9?=@25+ 6"2+@2+@,((,>?25 6"= 25+ 25=3*z3"_('*y%Ag 2 " 6"3y"+g4"153++@(,(?>2 6<3+  7=++A%v23{= " 6"3y"v4 * 6"4@+++@%_5_*4@_+_+_+@%v55 24"2 4!2 2 9?=@25+ 6"2+@2+@,((,>?25 6"= 25+ 25=3*}3"_('*|%Ag 2 " 6"3|"+g4"153++@(,(?>2 6<3+   7=++A%v23~= " 6"3|"8;;4k 2v4  6"4*@+++@%_5_*4@_+_+_+@%v 6"15+2%5=552Fl4!2 * 7=w4X! 2=/2!+=2!_=2!= 2!=j2!=!_4! 2   *:@=  8> 6"=5i4!  7=4!  7=+@,A@,?25+5x 6(1  6(15+5xiqi&q3i5yuu&%q&u4xi;4y+@,@,?25+@15+25+25+ 3( (h%g%%%'v%x%%u u& ii&53+@,@,?25+ 6(1  6(15+ii & u& u#u&#3i5y%q&+@,@,?25+2+5+*3(*(h%g%%%' * , %,%u&&&%u.&.i1i&1#-#(-#7(7953;5<5=5>5?5@5A5B5C5D5E5F5G5H5I5J5K5M2 M8 M?8O M?OP M?P2M#=### #2##4!NRN 6KSN5UU4!VWV5 U5t*gQg?Q25+g4T[5*X@ 6"2W+@2N+@,Y+@?Y2G]^%^+@2%@_@?_2&=&h%%@2g%f%= @2g%f%=g%f%=&h%%g%f%"]"3c "]4&4ua&a%$5y$5y 6"=4g5x`i%`*\g5x 6"2+@2 +@,j+@?j2l5 6"=3"rr'grn5zr o5yru&rwk3}A %kr%+r2@2 @sl?s2y5A++@x@>x23 {5+@2+A | 6"2F+@2=+@,z+@?z26&d&d&|u&|%%%h%g%f%]%]%' $i& 5y5255=55 6"=ut!v2vvtu2vvuv!v= 5m"vv%p  5m"v 5m"vv%v%t 5m"v 5m"vv%v%u 5m"v 5m"vv% v%t 5m"v 5m"vv% 5m"v 5m"v 5m"v 5m"v 5m"v 5m"v 5m"v 5m"v 5m"v 5m"vvw% 5m"v 5m"vvw%H 5m"vvw%H 5m"vvw%H 5m"vvg%vq&vu& 5m"vv% 5m"vv%v%u 5m"vv% v%t 5m"vv%v%u 5m"vv%v%t3}ww4w 5m"vvw%v%u 5m"vvw%v%t 5m"vv  w% v%u 5m"vvg%vq&vu& 5m"vvg%vq&v%v%t 5m"vvw% 5m"vvw%  !5m"vvw%$ %5m"vvw%( )5m"vvw%, -5m"vvw%h5n " @> 23h++@2@>22&@3_+@>32 _5 6<65=5575_85_5_5_95=B@2% 6"1211+@11+@21: 6<= 18515151951 6"1== 6"1211+@1 1;515151<51 6"1=Z4>>42Z4 =K ?23=F@=B>=2@4=< 23m=7 C23h=2 23=- D231=( E23K=# F23[= G23b=AI>A24;=H>H2 2gJ%J3 23 %++@1+ \23:=\  230=W 23=R L23=M M24L=G N23Z=B  2v5=; O23=6 P23=1 Q23=, R2S5=% T2U5= V23= W23= X23 = Y23=  Z23)= 23\\2 \4 [2\5\\=KH'Kh%  8~i5y 6{H]']%h%g%q&l`l%`l_51 b4i4444+ 2@23  2@23  2@23 @2 cad?a24+e %e*^g2+,ifgjj>f2+h4hgkgh%k,ilgmm>l2gn%ng2g%+*q@2 (5z'tp% ,%=@2 5z'up%j,%= ,5z'vp%,%  w 6{3 3"}}'~}o%o}*r}(|}({}1%@@,>2+@2+2+, 22p 61@>%2"r"r%=p 61 245p4!55  8~' h%(, 25zA%#2p%*`=#2%*`"#3+@>+@,>2q@21j2 #2%*`4*r%+#2%*`4@@,>2+@2+2+2+ 2j  2)R  2\ 21(@>%2"O"O&%%AA@%h%' #2%*`  8~"#3*5z%   6{3 *5z%   6{3 *5z%   6{3 j2%j\2%\j2%jj2%j >2= 2= 2= 2= 2= 2= 2= 2= 2+ ?2+552 22+%@@,>2+@2+@1+""3" # #?2=@>2=`  ?2%=U  ?2%@>%2 2"q"q%="p"p%=7  ?2%@14@@>%2 2"T"T%="V"V%= 2 %@>%2"U"U%=41<  8~3@125A%"" >2+@23%23c "1' h% #2%= #2%*`"#35z%'*c   6{3 5z%'*c   6{3 5z%'*c   6{3 5z%'*c   6{3 5z%'*c   6{3 5z%'*c   6{3 @@,>2+@2+2+2+""3" 2 j2=`%=* 2 \2=`%= 2 j2=`%= 2 j2=`%1,3  8~"" >2+@23%23c "' h% #2 %=#2%*`"#3*d@25z`%?=5z`%%'  w 6{3 *d@25z`%A=5z`%%'  w 6{3 *d@25z`%=5z`%%'  w 6{3 *d@2$5z`% = 5z`%%'  w 6{3 @2%@2 %A%'3=,@2%@2 %A%'3=@2%@2 %A%'3444@@,>2+@2+2+2+#2H '   ?2 %=i%*` 2  8~h%A%' A%?%8%=3R 2&  8~h%A%' 9%5%A%A%@>%2"Y"Y% 2   8~h%A%' ;%6%%@>%2"Z"Z% 2*  8~h% A %' =%7!%!"A%"#A%# $ %$@>%2"X%"X%%"#3* '(5zH'')%   6{'*^'+b%l%(w%3 * '-.5zH'.'/%   6{3 * '15zH''2%   6{'3^'43 * '65zH''7%   6{'8^'9b%l%(w%3 @&@,>&2+@2+2+2+?A52.@@@ 2)?]55 2@>%BCC>B2E F 7,[4D%D"KG"K%G4@">"3<">HII%HJKK%JLMM%LNOO%N=1==@=1=5PA=%P322?R5?4!;;5S522?R5?4!;;5T522?R5?4!;;5U522?R5?4!;;5V55  8~4" <Q>Q2+@2W3%W23c XX[[\\1+3"ZZii &Z'}Z(Z]%]Z 2Z'b=6Z 2Z'c=0Z 2Z'=*Z 2Z'=$Z 2Z'=Z 2Z'=Z 2 Z'@>%2"La"L%a= Z 2Z'=Z'D Zd%dZe%eZf%fZg%gZt% Zrh3}\i%hZsj3}\i%jZ%Zh%Zg%Z5zZ   6{Z*:Zki%kZ*@l@,>l2+i4 24+@1+2+2+ q>q2"#3+ #r #?rs #?stu@u>t2"#3+3o 2 ]%vww%vn=B 2 ^%xyy%xn=6 2 \%z{{%zn=* 2 `%|}}%|n= 2 _%~%~n= 2 a%%n=4"#3+  8~325A% o>23%"p"23c "p4"#3 \>2+ ]>2+ ^>2+ _>2+ `>2+ a>2+++@2+@2+@1+@@,>2+@2+2+  ? ?2+ #2 3 >25+  ?,>23%3c 3"(4xi5yq^5&^qq&%h%g%% 25z'a% 2%%=%  %= 25z''`%2%%=%%=n 25z'_%2%%=%%=S 25z'^%2%%=%%=8 25z']%2%%=%%= 25z'\%2 2%%%%@%23%   6{*m*%23c @@,>2+i4 24+ 2#22+2+2+ 2 j2=`%=* 2 \2=`%= 2 j2=`%= 2 j2=`%13  8~""23c "' h%4"#3+@2+@2+@1+@@,>2+@2+  ?2+@1+2+  ?22 %!!=5+=A  ?22 %!!=5+=+  ?22 %!!=5+= 22 %!! =5+=+3"(4xi5yq5&qq&%h%g%`%'5z  w 6{*%*3c 44444444444444444444444444444444444444444 4 4 4 4 4444444444444444444 4!4"4#4$4%4&4'4(4)4*4+4,4-4.4/404142434445464748494:4jE2j4!D 2 4!;<  =8T=5nk?@4-?A2?k4!>;>< 6K?4!>>=5H??=44-F4- 6"C2CC+@2C=e2C=GeGk4E=IEE4!DJD2 C 8tC 6"C=4-45M53"LL'NL(LH%HL*BLe%4QQTTi4RRiTTT4SV4-Q2 Q4!UUm5HR24R4!UUm5HS24S4!UU5H4-3 XX4!YYL 5.3PZ4 4- 6"\2\\4!]\+@2]g \ ^ 70=]g \ _ 70\ 6"\=@14-+A@1@2l4!`l4,!a` a 8t= 6/+4-@24-=m24-=m4!bbm 6/l4!bl24b5H24!c4,!b d cb;24!c4,!b d cb;4- 6"f1f4-+4-2%k4-=l4-m4-2fCfl4!gngo 6/fw4X!hf f2fj=fjj/2!pi=j2!qi=j2!ri= j2!si=jj2!ri=!qij4!gf f2 hig o f9Z=hig t 7Of 6"f=4-wx4-y4-x4-z4-{4-!v2v+w2=(n4-v4G|4vXOvJO}vK}4G4vJ4G4vK4G4vL4G4vY4A4vZ4Av 6Kv!vww=4-2j4j2242244!<5H=4A@>%2=x4-4-x4-4-4-!"2)n4- 4G4  544G44G44G 6K!">2 4-X4G 6K"=4-@,~,%?~24-+x4-4-x4-4-4-!2!XYZQn4-4Gp45p45p45H!=4-4-4-4-4-4-!2.J4-XT54YU5r4QP54ZV54TUVPXYZQ5p 6K!=4- 6"x4-4-4-4-4-2.+@1%4-R4G4T4G4P4G4Q4G4U4G4V4G4W4G4[4  6K 6"=4-@>%2=x4-4-x4-24-4-=4-4-!232 w4X!p 6/=4-JKJKLTUVPXYZQ5q45o 6K!=4-42244!U5H2244!U5H2244!25H@>%14-+"14-+x4-4-x4-4-"2 w4X! 6K"=44-"24"=44-"2W4"=44-"2S4"=44-"2o4"=44-"2O4"=44-"24K4!K224 6KL4!L224 6K"=44-"2J44!5HJ44!x 6KJ224"=44-@24- 6/" 6/4-3@133u3@ %>233@234- 6/4-4-4-4-4-4-4-4-4-4-4-4-4-4-4-4-4-4-4-4-4 6"2 2" 6/+ 6"=4-14-+44!555 6/14-+4  4! 5 55   6/14-+4-  6/4-+@2 4-+@2 4-@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-+@2 4-4- 6/4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2! 4-4-4- 4-4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-@2 4-4-4-4-4-4-4-4-4-4-4-14-+4-4! 6/4! 6/4! 6/4-4- 6/4- 4!! 2!4+ 2!! 5t 2!! 5t!D "44'4$(4%)4&+$.4+/4,04-++3"44(4h%4g%4%4%4'24i3#&4u63*&64+%@314v%@314w%@314x%4i4!52<5 R 704u4!555H 2 2 4%4* 4##(#(43# @ @4!D? 6"C2CC+2Ci @E E42H?I D R8tCu4!DD5HC4+C? 6"C=J?I D 8t+ 2+i LN4PN L4=Pj>=2 i4!OHI O 8t44S"T3"(%%i&u&+%S2'~ S2%= S2%3s=} S2'3=w S2'3=q S2'3=kSQS >Q2@S1%S2'3=S2'3= S 2'3='3=M S 2'3=G S2'3=A S 2'3=; S2'3=5 S2'3=/ S2'3=) S2'3,=# S2'35= S2'3'= S2'30= S2'3= S2'3=4"T+i4!U<U  70"T+ 2+i XZ4\Z X4V\j>V2i 4![HI [ 8t43R2_D 4=E 44-3 aa4!bbL 5.c4d4e4f4g4h4T 4- 2U 4= 2V 4= 4!bb44,!bW b 6K4!bX b 6/Y 4-@2E 4=@2Z 4=[ 4\ 4-@4^] 4-@4^^ 4-@4^_ 4-@4^` 4-@4^a 4-@4^b 4-@4^i4-@4^4-k4kk]k>]2k4Tp 6"n2nn+@ln+@>l2pn 6"n=1ps 4-+4-r4-s4- 6"n2nn+@qn+@>q2 n(4!oJoo n 8tn 6"n=4- u24vviv4!wxwy 6/5t+ u 24vviv4!wzw{ 6/5t+ u23K= u23P= u23W= u23[= u23f= u23e= u23u= u23= u23= u23= u23=u tu >t2u 4= u23= u 23`= u23= u23=u|u>|}uF~u>~?}24v5@2+ u@,>2S5= u@>2S5=uu>2u4;= u@>23H= u@,>23H= u@>23X= u@,>23X= u@>23_= u@,>23_= u@,>2U5= u@>2U5= u@,>2g5= u@>2g5= uo2@5t=} u2v4*=x u2v4j=s u @,>2v5=j u @>2v5=bu?u>2+=\ u2A4-=V u@,>2l5=M u@>2l5=E ur@,>25=< u@>25=4 u@,>2 34A5t=' u@>245xq4@5t= u2A5t=uFu>2 uFv5uF4!ww 6/= uA251= u251= u24>= u2 A51=uu>23#  u2K4|= ut23R=W4|=uiuw>2M@2P 5tM 5tN 5tQ 5t 5t=P 4M 4N 4Q 4 4 ui2 @2A=A5t@=uu>2 u3 2A=@= uw2@4L44 Q 5t 5t=H u2@5t=@ u2A5t=9 uD23=5 u24-"=/ u23=+ u23=' u23 =# uz23= u23= u23= uH23m= u23y =uju\>2uj4=uk2uk4| =4-M 2 2+= 2+= 2+=+= 2+= 2+= 2+=+M 2' 2+="2+=2+= 2+=2+=2+=2+= ?2+=A2+=+=& 2+="2+=2+= 2+=2+=2+=2+= ?2+=A2+=+M 2 2+=A2+=j2+= R2+=\2+=+= 2+=A2+=j2+= R2+=\2+=+M 2! 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+= 2+M 2 2+= 2+=+= 2+= 2+=+r 2+M 2 2+= 2+=+= 2+= 2+=+M 2 2+= 2+=+= 2+= 2+=+M 22+=+=M 22+=+= M 22+=+=2+=+M 2 2+= 2+ = 2+ = 2+ = 2+ = 2+ = 2+= 2+ M 22+=2+=2+= 2+=2+=+=2+=2+=2+= 2+=2+ =+!M 21#+$=+%=1#+&=+'M 21)+*=++=1)+,=+-M 21/+0=+1=1/+2=+3M 225+6=+7= M 225+8=+9=25+:=+;\%@K+@?K2+M@&20r4!=p4!>t4!Au4!Bv4!C`@4!Dr2 q4!@=> @ ABD:= q4!?=> ? ABCD;= (4!E*4!F`@4"!G`@4(!H`@4.!I`@44!JMF E GHIJ;MLM@%L@2+@2++@2+@2+++@2 P5+N+%N25+M%+Q+A%Q@2p%q%= pRM 4%RqSN 4%SrT3 %TtU3O%Uu%% %V %?VW %?W1u%vX 4%Xv Yv ?YZv ?Z1v%Q 42`%=`%`[`\AAA@A\%[*]P 4%]* ^* ?^_* ?_`* ?`1*%(aR 4%a3<P5M 25r 2 r%@2pcM 4%c=p%=%r 2 r%p%q%u%=r 2r%u%=r%A@1pdM 4%d=p%qeN 4%e=M 2r2pfp4%fp2p%= pgp4%gpi2p%=M 21r2q 2q%= q 2q%=qhq%h=qiq4%iq\2q%=q 2q%A= qjqA%jq\2q%=M 2 t 2t%=tkt%k=M 2u 2 r 2u%=u%=ulu%l=~M 2 v 2v%=vmv%m=pM 2`@2`n`%n=`o`A%o=`M 2 *p*%p* 2*%=SM 2(q(j4j%q(Gr(?r2(%=@M 2`@2`s`%s=`t`A%t=0M 2`@2`u`%u=`v`A%v= M 2`@2`w`%w=`x`A%x=M 2 `@2`y`%y=`z`A%z|53 ~25P5r2 p2p4q2q4*=p{M 4{2M p5tqN 42q4 v 42 v5tu%2u4 t3O2t4;`@Q 42 Q `@5t`@4!5*P 42*4L(R 42!( 2!=( 2!=( 2!= ( 2!=( 2!=!R 55`@@23H`@@23X`@@23_`@@2U5r~2r4++%+++@%@1\23<,,>2A%=Z2,@%MM@&%M 2M%M 2M%r M >2M%= r M >2M%3<5=-2&@%MM@&%M 23}+=M 2M%P5= M 2M%P5=3b3<=\23<+4q&u 2&= u 2&=u4x&;u&u23h%5zg%]%'D ""  6"14c*d&*i 2q&fG%+i  4G2q&fG%+f%q9&9d5yq&%c2c3#34\23"'\%*(#'))''+# D >2 #5.2#[  8~)2 ") 6"1+412"#" 6"1+""""223"""#1g 2i^b  7 F2+ N2++ii  7 2 @2 2+>OP2+ F2+ F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2+ii  7 F2++""/2%/g g ?2-3"+( 2e%5%*-3"1+@2+< >25+ 2z >2n(%,%?20 2  ?2 @,@?2XX%=  22ZZ%= 2QQ%a%= 2YY%=4 >%2/ 2  ?2 @,@?2%=  22%= 2%a%= 2%= 2%"$  >2( %  >2 2 2 2q@2q@247  > 2  >  > 2?,%?2  %2G@,?242 %AA@%%424=4@2 %%(g >G>2i^b  4 q!q$$&! H>*++>*,>,2I%@2 - >-.>.2 44!0  188@2@1+52:2 2  8~:/%/+ %3>345 5>42 2 2 2+ 6 >67>78,%9::?9>82 Y;Y<<%;Z=Z>>%=?%?2 @2 @ >@A>A24!C  D99C  9?5+"",2,B5B"H?MFiM5"N2N1NI2-N2+Ni'NUNU'OFi O4LLKK2KHKKK2NFJ 62NG'JN@T@>T[ J>[2K KNG2NFG K 7=RKSNN=2RGFG S 7N4^!^N4d!_N4!`N4/!aN^ _ b`aC;4xiiX; X  7F2 N \N+@>\2Ng g23]@2l  8~{h{m{@m%h n p?n24z12c,%o?o2B 613k+G'q4q42  8~  73k+uubG%u2  8~  7 2iq 6iu%4xh 2qdq&di5y=qq&=qq&{@,???23k+u4xii>,; r r4~52 ~j2 r4r=~j2 r4~rq&r@1 q q&@2"iO 4+ >2   8~+%=+ >2   8~+%Oi&b%{@,?23k+i4 23k+ >% >23k+25G'  7 2iq 6i=55j5k5l5h 2A%i5yq&=q&qq&=   8~y&+%(b%*q*{@,??23k+ii  42g%2b%*ii u 4&iii 5yb%32+{{A%3G%3"'p(z(g%h%4x2 q5&uq4&y&*%*5z  6{i;5y@1  8~=  8~"273"'z("((%g%h%uq4&5z  6{u4xii> ,   ;i 5yb%*=z(+@2+2+@2+{@143+=3kp 6""2"" !2"#""3k"#+"p 6""=4 '4(4)4*4+4,4-4.4/4041424344@2444l4445464748494:4;43}+<=<><?<@<A<g%q&*5zh%3<4xiD D;D  7 F2+; GGN2&NA%N 2 G  6i=  8~55G5H5I5N  7=  8~55G5H5I5q4 K3}>KN3}AQNQ4 KJKKK\K+K3"^^'_^(^g%^h%u4x^q&[^t^t`3}A`%^y&b^a%a^*^f5z^  6{^ X5y gjG m 73J piTp T po 6i wz   7"}~1}+} ~ 71+}23~"}=~~3j>s3jAs4 J\ GN2N 2   6i= G   7N5=55555@,e@?e2TT%72  %4xi;ax323jA3j>   7F2 5=3*  8~@1%%4x5    6 23+2  8~@1%%4x5     6 2+i4 24+3}ja%%2G'  7F  8Ea1i 5"2 >,%?>2a%"==a2n,5>2%72  %iiq4 &55j5k5l53B@1%%)  8~3"(g%h%'4xqk5&qqk&uq4&*%*5z  6{i;5yn%A@1t2iiq  7FL?2n%=n%PPF%    7N2 G   7N  723%3c +2%3c @2 o 7=o  8E+N2   8~N)%@1%%i4x ;5  7 G4  G4 ?>2%3c @2 o 7=o  8E+555555G5H5I5VV%72  F% ;G  7F  8E55j5k5l53B 2+ 23 +1  8~q 2y&@1 % %@2mm%m2 %3%3c 50  8~3"  ( g% h% '4x2 q;5>\3jA3j>&=  ql5& q  q5&  t%\ y&& u# q4&# *  ,% *  5z   6{ i5y3"""("g%"h%"u) 44&)"*."'"*"-%-"5z"  6{" 15y"q947&9.  8~38 %8@1D%DE%E4xUFU%F72 G %Gq@2 3%I5 @i @I 60= k5 @i @k 60"*/"5z"  6{4xH >H23?+2O3%O3c +(  8~3P %P4x@1Q%QR%Rq@23%I5 Ki<AJ< KI 60= k5 KiTAJT Kk 60USU%S72 Z %Z 2+h 2+i4 24+2 24nG'\  7=5 ]25=  ^25=5j5k5l54 2+h 2+i4 24+2 24nG'_  7=55j5k5l542+3$[`aAAA@a`%[ 2%'c%= 2 %@2'6='c%=p 2 b%b'%dA%d=a 2 e%e'g%fA%f=R 2 h%h'j%iA%i=C 2 k%k'm%lA%l=4 2 n%n'p%oA%o=% 2 q%q'%rA%r= 2 s%s'u%tA%t=%'D %wv>vx@w>x2+y@w>y2+z@w>z2+{@w>{2+|@w>|2++2+ } ?}2+3%3c +<2<%>23~1+32+4xB%e% 2"  8~3}23= 23=23=3q@23%3%=3%=h 2 D13 =3 3G%=\ 233q@23%3%=3%=K 233q@23%3%=3x%=: 23=5 23=0 233 q@23%3%=3)%= 233q@23%3%=3%= 2 33G%  8~ 2 @25%+=M 22=D 22=; 22=2 22=) 22=  22= 22= 2 @2= 2=%@15+25+?2g%%3c %g%2d 2%=U 2 @2%2=%=F 2%2=< 2%2=2 2%2=( 2%2= 2%2= 2%2=  2%2@ >23c +=%g%2` 2%2=M 2%2=C 2%2=9 2%2=/ 2%2=% 2%2= 2 @2%=%= 2%=  2%2@ >23c +=%g@15+g%g%  ?22=  ?22=  ?22= 2223%3c >23 = 23 =  23=  23%2%%32+@233=32++A% {@?2q@272+7q@?2->2*>%@1  8~=7q@>29  8~=q@28  8~=  8~q@2s2s%@1t  8~=;  8~q@2:2:%@12  8~=7  8~q@2t2t%@1  8~=:  8~ 2+i4 24+  8~iWq4 W2 2 q   6i   7=555554 2  8~ 4 3"""("g%"h%"%"5z"  6{" 5y"q5&"u"q4&"%"*"*""n3 3A 2]5=544 444444444[44444444444444444444444444444444444 4 4 4 4 444444p 4444444c44j4p4g4m44444444444f4u4(4t44u4,4v44444444444444$4 44444(4424.4-44414444644444 44444444444555 5!5"5#5$5%5&5'5(5)53 @1@2 2 +2  6"* *2,43 %%2=3X/.04413}142 2122220.3+3uI&83AAAAAAAAA+@2A++j,\-j.\/j0j12:33210/.-,+@239=@1 A+j,-./0123= AAA+j,A-./01234567AAA93210/.-,+@239=@1 A+j,-./0123= AAA+j,A-./0123+4n56(78+%4n%5%6(%78%q<q=q@ =%<3%+o%%,%-%.%/%0%1%2>3 %>M%1N%1L%1I%1H% 6"A2A3}BB2A 6"A1AA 6"ABB=+AC 6"A2A+AD 6"A2A+AE4+F44+@,?+@??2u&&%2+H?H23QL53@"||I 6"2(KK&6|I&6uM|I&M%I%I%h%g%f%]%'D |i5y"J"3"J 6"=5 23 =SG%S@2+2+ 4 U 4 W">W?U2+2 2Y5Z5(+[5 D 2'3**TXG%X'.2^43*V4`353X2++@2+@2a5+3 2+b53_33Y5%3 {\{c{@c%\]%@,d@?d25JeJ%e@24J@2+fA@f1 +g+A%g3 +h+%h+3  i+@>i2jn 6"j j2jn 6"j+j=  m+@>m2kp 6"k k2kp 6"k+kk 6"k+k 6htt4t 6"r r2u4t2 r 6"rr2tt="r2Qr2] r2t=2ss os+@>ovs+@,>v2t"s=ss= t2+rtr 6"r r2.t]i5"s2ss ws+@>wxs+@,>x2t"s=ss= t2]+2e% 6"r r2r 6"rr2+r+=2&z 6"r2r+rC 6"r1r{4+r@1 6h4 6"}=e,>2  6h3l"}=  6h 6"}42e,>23l"}=} 6"}}2="}2r}2'] }2=e,>2}i5"~=}i5"~2~~ y~+@>y~+@,>2"~=~~= 2+}e,>23l"}=} 6"} }2;e,>2]i5"~=]i5"~2~~ ~+@>~+@,>2"~=~~= 2]+e,>2e% 6"} }2} 6"}}2+}+=2&z 6"}2}+}C 6"}1}{4+}2+2+@,ae>2A%&uP|I&&P%%|i5y%h%g%f%]%' 53;2%@2+@,+@,>+@,>2 5n+3|"]('%j%h%g%f%B%%j%E %a%7%8%6%5%%r%9%%%q&3c  23 3%,*4-*%u4O y&}&i5y/%C% 2 p 5z]5z]f5z]   6{&24"Q4=3 4 "2 41!"=@&1!"A&&=@&1!"A&&= @&1!"A&&=@&1!"A&&=!"3"''"=( "23"''=! "2 3"@& &&2''=''= "23"''=  6"1!"3"''" D 2'* G%@2q42q&=qq4& 2 ??2+%+,,>,>2+%%%3 @2+2& 2t%j=  2t%F=t%AD2D%3}2   8~=   8~+@1+@1+A@%e%%  8~ttM %1   8~@%+@1' 2  8~ 2  8~ 2  8~A%%E %a%2E2  8~= E2  8~E %a%=E242aa%a 2a%G' a 74% 2282%= %  7= 28>2 %  7@1 q q& 23ju4xi= ;4;    7F2    7 F2A%t%@%%w23*gf2gf%2++A%23G+x@>2"w 239  39 ?25 6=w  2 39 25   6x%[23 [%+@2++A%3@2q& 2@?23i+24+@23+2 ++A%23+@2++A%q&+G'D @?23i 2+23=A%1>2323%3c ij5"2ii 4j2ii 4 ii 4jqq&qq &=62u% 2]%   6{%@2@%6%;%]%   6{@2  2%  2%+<2   8~<3}%62; 2  5  8~; % ;2; % 62]%   6{3$  @ % 6%;%@2  2%  2%52T@2  @ % 9%5%71  @ %   @ % ++@235  29 2  5  8~9 % 929 % 52  @ % 9%5%71  @ %   @ % 72P@2  @ % 7%=%51  @ %   @ % +7  2= 2  5  8~= % =2= % 72  @ % 7%=%51! " @" %! # $ @$ %# 82*E%  %% 8& & 2? 2 ( 5  8~?' %' ?2?) %) 82 * + @+ %* ?%8%@, 1>, 2- - 25. q@,>. 2/ %/ 10 %0 =1 2 @2 %1 +@1+24+@23+2*e%26 3 1 >3 25 >5 2  2%=6 %6 7 >7 223 =8 %8 +@2+9 +: +@: %9 +3+@2 2%d23cd;  %; @1C< t%< =*C> 2'2$ 2  8~=C? 2G'@   7  8~=  8~C%6= 5A= A 7AA B 8AB C j?C 223q@2&r2#rD %D R2 4 E %E R2%RRF >F 2 4 G %G R2%R 4 238' 2H 55(H 3I 25(I 3r1+2 845 4O 2"~  5n+e%3 +@1+42'M ] 2]%   6{4!K 4,!L <12N K  L 8=O 5@,J @,?J 2b2  8~=  8~5%+@1 33Y3 {P {Q {@Q %P 3 3_ 5z   6{' 8' %%w%%R AAA%R @22%T S T U %S T "U 5T wT " 6=T U 52 T 2  6"W 2W W *=T V T U %V T 2 >21 i44!Y Z 4[ Y { 63 3}b \  2\ H2 6"^ ^ 2 ^ X \ X 2^ I%1^  6"^ =]  f 2:\ >%e \ g ]  g >e 2] Kh ] K%h ] 72] i ] %i ] 5\ k ]  6=,%j \ l ] l ?j 2\ Lm \ L%m ] 5] Xn ] X%n \ p ]  6+]  q 2 r \ s 6\ Lo \ L%o \ 5+]  u 2\ p ]  v 7\ Lt \ L%t ] 5] Xw ] X%w +\ G y 26\ x ]  x >%z \ ] >z 2 ] K{ ] K%{ ] 5] } 5+="]  | \ ] >| 2\ L~ \ L%~ ]  \ 6] 5] X ] X% += \ J \ J% \ 5\  5++]  2 \ ] 2J] J ] J% ] 72]  ] % ] 5\ G 2 \  2\  5=\  5+=(\ G 2 \  2\  5=\  5+=\   \ > 2\  2\  5= \  2\  5=\  5+\  5+=s % \ >  \ ]  > 2!] K ] K% ] 72]  ] % b 2! c = b 2! c =b 2! c =! c ] c 5] 5+=J\ H \ ]  > 2] N%\ L2] W ] W% =] W ] W% ] 5_ ` ]  2! a =]   2! a \ I ] H,> 2] 5` ]  a  7] U ] U% ] H1}] iE5"^ 2^ <^  2^ ]   ^ H>  ^ ] >  ,` > 2] 5` ]  a  7] U ] U% ^   ^  ? 2]   ^  >  ]    ^  > ? 2] 5_ ]  a  7] P ] P% ^ ^ =\ iE5"^ 2^ 8^  2^ ]   ^ H>  ^ ] >  ,` > 2] 5` ]  a  7] U ] U% ]   ^  >  ]    ^  > ?  ,_ > 2] 5_ ]  a  7] P ] P% ^ ^ =] 72]  ] % \ L \ L% ] 5] X ] X% !D d ] b \ G \2! c =w\ G _2! c =r\ G 2 ! c ! d \  2@2! c =! c ! d =c\ G 2] 723}b b 2! c = b 2! c =b 2! c ! d = ! c ! d \  2@2! c =! c =C\ G 2! c => b 23}b b 2! c b 2! c b 2! c ] 7 \ 1> 2! d =! d =' b 2! c =# b 2! c ! d = b 2! c ! d = b 2! c ! d ] 7 \ 1> 2 ! c ] 2! d =! d =] 2! d =! d \ c ] d 7+=i\ J \ J% \ 5]   2\  5+\ G @ 2\  5+\ G \ \ G _? 2\  5+\ G  2\  5+]   2\  5+]  2\  5+\ b b 2 3}2\  5=\  5+=# b 2 3}2\  5=\  5+= b 2\  2\  5+3}2\  5=\  5+\  5<  %r s? 22%3$+   ? 2 2 22% 2 % = 222% 2 % 2 2% <$%r, s,> 22%3 +   ? 2222% 2% 2 2% =222%  2 % 2 2% < % A% < !%<!%< !%< !%< $%< !%<F!%<!%3C<#$%<!%<! !%<& !%3C<$%<' !%<( !%<) !%3C<!$%<!!%<!!%< !%3C<P$%<!!%<! %3!< %D13!+q4!2f23&+<&%D13!+q4!23 +<P$%<! A% 13$+!%! 2%4I3! %!<!A%!13$+!%! 2%4I3! %!<!!A%!13$+ !% ! 2%33!! %!!<"!A%"!13$+#!%#! 2%33$! %$!<&!%%!A%%!<(!%< )!%<K*!%<+!,!%<*$%'!9?'!2+$ f 2  8~+ 0! >0!24-!3}2  8~=  8~+ 23}2   8~=   8~+ 23}2   8~=   8~+42A%+41!%1!A 2 A%  8~+3}4/!'D  /!2'= /!2'= /!2'= /!2'= /!2'='  8~+<o4!3.!%<5!<6!< 7!< 8!<?$<:!3.!%<;!<!<$2+62+42+ 2! ?2!239!=33!2+3"G!G!5zG!i5yG!g%G!h%G!q&H!G!?!%?!G!* G!'L!G!%G!b%G! M! P! 6{K!G%K!*F!ES!E%S!ET!FT!243"W!W!'X!W!i5yW!g%W!h%W!U!G%U!W!*F!W!E%W!(W!F%V!+ 2  24-!  8~+3}4[! [!2' [!2' [!2' [!2' [!2'  8~+1   8~4]!43 3 %Y!_! _!%Y!l`!la! a!%`! 243"d!d!'e!d!uc!u&d!b!c!'b!d!]i!c!]%i!d!j!c!%j!d!k!c!%k!d!qf!c!q&f!d!g%d!h%d!y&d!%d!wl!c!w%l!d!p!c!%p!d!q!c!%q!d!c!c! 6{d!c!i5yd!vr!d!x%%r!d!*^!d!%d!f%d!s!%s!%%C%3@2t!%t!* =1u!F%u!*\!3jjy!3jjz!3}j\{!x!|!2y!xy!=x!}!2y!y!=y!y!+y!3"!!i5y!!5z!  6{!qm!!4w!&m!!g%!h%!zv!3}5%v!!{!3}5%!!|!3}5%!!*^!!%!f%@2!!!3}!%!=!!!3}!%!!%!%]%f%g%f%%h%&!   6{q!!4w!&!l!l%!!!@!%!y!3j!&!4!@1 5~!5~!@15~!%$ f 2  8~+$ q 2  8~+3}2  8~=  8~!!!AAAA@!!%!6%5%7%8%!!!AA@!!%!]%@24J@,>#23Y5%3+!+A%!%!%!'D &!%h%!!@!%!g%f% !@,>!23 3i+t2t!t!3} !%!3Z!v%x% ! ?!23E!+3}!4! !23@!= !23A!= !23B!= !23C!=3D!2+%ih%g%f%%%<A!<!<!<!<!<t!<!<!<!< !<i!3i<!<!<!<!<w!<!<!<!<!3i<D!<!<!<!<!<z!<!<!<!<!<F!<!<!<!<!3i<}!<!<!<!<!<H!<!<!<!3i<!<!<.!<!< !< !<j!<!<!3i<!<!<!<!<r!<!<!<!< !3i4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+.2!4h% M! P! 6{3!@!@>!2+G'y  a 7[2n 23!=3!  8~n%@2+*!!f![!%!  8~n%  8~2%"%"n%o." 6n 2+n 2"f"["%"+  8~n%s.! 632"42^  8~' ""@2n "n ?"2 ""3!" "> "1""+""3!" "> "1""'D 'D 'D " "3"" "@ "@> "2+2+32+3"%""#3 """"%"%3 """2++@23+32+3"%"D 2 5[  8~1+@"@>"2+"@"""2S 2(( 2 "5  8~=( 2 "5  8~= ( 2 "5  8~='( 2 "5  8~=( 2 "5  8~= ( 2 "5  8~+"""%"*2*3 "3"("("'/"("g%("h%("(("*" "")" %","(" )"0","0" 6{+("4" "5" "2+4"6"5"6"2+4"7"5"7"2+4"8"5"8"2+4"9"5"9"2+4":"5":"2++2+@2((+?"B"">""="(>"2>";"%;"2>"E"'E"D 2>"F"'F"=" 6"="1="(>"2+2+2+]G" ?" B"5!"(G"+="53"2 ="2I"4(=""="="?"2="?"="@"2="@"="A"2="A"="B"2="B"="C"2="C"="D"2="D"1( 2 K"44'K"^'=( 2 4L"4'^'L"=( 2 M"4N"4'M"^'N"=O"4 2 P"4P"4'P"'P" 2  4Q"4' 'Q" 2 R"4S"4'R"'S" 2 T"4U"4'T"'U" 2 V"4W"4'W"'V"3H"%H"h%g%i5y5z' *!* "@2%@2%.1.%j[1[%m1m%a1a%o!i&!sY"o\"_"b"b"4m_"e"\"e"&Y"@2 s5ysh"o&h"ok"i&k"n%2%-*"2[%*"*<"X"fG%X"%lin"mn"2+' 3@1,*%q&  8~q"fG%q"@z"I4xN1@2N~">4%~"=N"A4%"M1M";4%"@2S{"i"N>" ""&{"=S"i"Nz"A"""&"W"S"M;"""&"S.r" 6  8~"f%"*s"  8~  8~W.t" 6  8~@1"f"["%"*u"  8~S.v" 6"f%"*w"  8~  8~m.x" 6."@?"2%l%,*y"  8~@"@>"2+32+3"%"G'y  a 72++@23+32+3"%"2 5[  8~ 2% 2 "4"4 4'"'"'  2 "4"4'"'"'" 2 "4"4'"'"'"a1a%I"u&"u&h%g%' 5zi5y*"*".%A*y"."@?"2 %l%,*y"-*y"m"i&"[1[%n%"f"["%"*"#3%n%n%o." 6%2%n "n ?"2+  8~n%s." 6(#3"@2+2++@2+@"@,>"2+(3"($"%"%3" 2"4'" 2"4'" 2"4'" 2"4'"3g%h%5z*"*"2 "%"-*"%=*".1.%?[1[%m1m%n%o"i&"s"o""""4m""""&"h%2"%"%h%2+ "2 2+))52  8~%#3[2*""[%"=*"G%"*($3"(#3"2+2u4x;2+(3" 2"4'"= 2[4'[= 2"4'"[1[% *"32@2"4"%"-*"%h%i5y=@1*"[%3"*''[%.2'"1% 2"4'"= 2[4'[3"l"l%"l2+l2!# "@ >"2l2#"5=l 2#"5= l 2#"5=#"5+# "@ >"2#"5(#3"[%l1l%*"3}""2!"="2!"= "2!"="2!"=!""  8~43"""'"" "5y"" %""*"55"5"5"5 2+ 252'q 2 # 7+2 # 73"##'f #g%#h%#u&## ### 6{# #5y#*### %##*#(#!"# 6" #1 # ## 6" #" #"+ #22+@22+ #h? #2+3i4 2 6"#=3 #"#1##44+#I4x#i";"# #4 #i5 1 #i5yq#r;#s;###&#+#i5yu##I&# 2%#x%#@2%#&#@&#%%#q"#; &"#='#+#@+#%'#I(#u&(#u&'D i.#i4#&.#.27#4,# %,#!* "9# ?#>9#># "@# B#>@#?>#A# "C# E#>C#?A#D# "F#H#>F#?D#G# "I# K#>I#?G#24+3*#.2L#4*8#@1 M#41#1#;#iM#  742+32+3J#%J#42'D 34= D 2 5[  8~[43*R# U#2+222+ a 7%S#%S#+3* a1a% V# }?V#2qN#.Y#Y#&N#=2qZ#.]#]#&Z# 2 @2 @a# %a#c#  8~@243c#4*X#.1.%k43"m#m#'t#m#*f#m#g%m#h%m#(u#n# x#q#rb#vb#s#p#@2p#s#A2{#{#n#n#q#A2|#|#o#o#r#m# n# q# 6{  8~n%*j#}#f%}#  8~n%  8~n%s.# 6  8~n%o.~# 6@2+@,#@>#2+2+2+n 2b2+3i#+=n 2#f%#b#%#@2+@,#@>#2+2+2+n 23j#2+3j#G'y   7n 23j#=n 23i#=#4*n2#43j#M1M%FN1N% 2% 2 #4#4'#'# 2 #4#4'#'#I^#u&^#u&'#h%g%i5y5z 6{*k#.1.%Ro#i&#s#i&#w2v#l#w#%#=v#l##%#*h#3l#2n%*#=s5yn%32+3#%#G'y  a 7#2+3#[2 #f#[#%#  8~=#f %#*# 6"###'#.2#4#[2[##[%#=[%  8~#i# #.# 6 6"###'##i# #5y.2#f %#*#.1.%j.2#4a1a% 2 'P"P"4'P"P"4 2 '##4'##4b%h%g%*#*#'#5z 6{i5y#f %#*#.1.%j.2#4b%h%g%*#*#y&#'P"P"4'P"P"4#4#5z 6{i5y#f %#*#4 "#2@'%j%h%g%q&&#u&#%B%%jE# %#a%7%8%6%5%%9%3Z3;3c %%\%%j3%%5z   6{3 =4@2 +5#%#=+)5#%#.24++2 *#@2+)5=+5+2 *#@2+)5=+5#4i#  7+1+%#4i#  7#4#5z4#4i#  7#4#5z3#4#4#5z%3#4#4#5z3#4#4#5z3#44' 4' #G#3}#%#*#.1.%k3"##h%#g%#q&##r#3}jA%##s#3}jA%##t#.#3}\#%##' #5z#  6{#i5y##%##*#*##3}%#*#  74T  D 8E'  8~i z  7l#l%#3B%' #G%#*#h%g%#4#5z'4%-*#%l#l%#l#5l#2 #4i4444h%g%#4#5z'4%-*#%l#l%#l#5l#2 #4i4444@2   8~i5=.  8~i 60@2"*/3##[%#"q# &#3*#@2444=.43#[ 2[%##[##f#%#*#443"$$5z$i5y$g%$h%$q&H!$#%#$* $*#$'L!$%$b%$ M! P! 6{$3}%$*#3"$$5z$i5y$g%$h%$q#q&#$$%$$* $*#$'L!$%$b%$ M! P! 6{%b%24 $ $2+4b $b% $b 23$b 24r$3}1$ $s$3}1$ $t$3}$ $ $2 $ $12 $ $2 $ $12 $ $2  $ $2 $r% $s% $t% $$%$* g%h%45z$%$u&g%h%*$5zu&g%h%5z4@&1+u&g%h%*$5z@&   2+u&g%h%*$5z$4i$  7$4i$  7#4i#  7 $4i $  7"$4i"$  7$$4i$$  7#4i#  7'$4i'$  7)$4i)$  7$%$  8~  8~,$  8~-$  8~.$  8~/$  8~0$  8~44,$4-$4.$4/$40$42$43$44$4+$G5$3}5$%+$**$7$ 2+8$7$$2+9$7$2+:$7$ 2+;$7$!2+<$7$!2+=$7$!2+>$7$!2+?$7$2+@$7$!2+A$7$!2+B$7$!2+C$7$2+D$7$!2+E$7$ !2+F$7$ !2+G$7$2+H$7$ !2+I$7$ !2+J$7$ !2+K$7$2+L$7$!2+M$7$!2+N$7$!2+O$7$2+P$7$!2+Q$7$2+R$7$!2+S$7$2+T$7$&!2+U$7$(!2+V$7$)!2+W$7$*!2+X$7$,!2+Y$7$42+Z$7$3!2+[$7$4!2+\$7$5!2+]$7$6!2+^$7$7!2+_$7$8!2+`$7$9!2+a$7$:!2+b$7$;!2+c$7$!2+f$7$@!2+g$7$!2+h$7$!2+i$7$!2+j$7$!2+k$7$!2+l$7$!2+m$7$!2+n$7$!2+o$7$!2+p$7$!2+q$7$A!2+r$7$!2+s$7$!2+t$7$!2+u$7$!2+v$7$!2+w$7$!2+x$7$!2+y$7$!2+z$7$B!2+{$7$!2+|$7$!2+}$7$!2+~$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$C!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$D!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$E!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$7$!2+$+i$i $$u$ $4&$u4xi$i$>$,$$$$$;$$i $$$$$$5y6$b%6$D%@2l  8~ $ ?$24z1D2"$z3$"$@2+,$ >$$?$$?$?23$++@23$+h 23$+2_,%$$$?$2B 613$+G'q4$q4$$$$$2  8~  73$+u$u$bG$%$u2  8~  7 2iq 6iu%4x 2 i$$$$5y=q$q&$=q$q&$u4xi$i$>$,$$$$$;$ $$ $4$52 $j2 $4$=$j2 $4$$q&$@2 q$ $q$&$@2"i$O $4$$$+ >$2   8~+%=$$+ >$2   8~+%O$i&$$b%$@2+2wi4 ?23$+=oh 2% %>%23%%%3$+A%2  7 2iq 6i=55j5k5l5=   8~y&2/h 2 i$$%%5yq %q& %=q %q& %%%%@2  8~+%(f%%%%b%%*$*=%b%%*$,% >%%?%?23$+2%b%%*%@2+@2+D%3"%%'%(z(%%g%%h%4x2 %q%5&%%u%%q4&%%y&%*%%%%%%*%@1%5z=%45z%i!%;!%5y%  6{@1  8~=  8~%"%2%=3"%%'%z(%"%%%(%%(%$%%%$%%g%%h%%u%%%q4&%%@1%5z=%55zu4x%%i)%i,%>/%,/%2%,%2%5%;5%8%%i 8%;%%;%>%)%>%5y%  6{%(%b%(%%*$%%=%z(%yH5YzH5Y{H5Y|H5Y}H5Y~H5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YH5YOݱ\ݱ> bݱR iݱlpݱ|yݱݱ!ݱBݱD)ݱLZݱDYݱijsjzh~!h(hqhHhNhwh hh+h8 hEhSh_ hg .h7h<e =+ T4#+B0v49E*Ko3V<^zE`zMbzo\zg{%a7o'68_+ee ) n <C 9l I Y[ i yY 9 !` !n &"| -3" 0~"7x>8x>9x>:x>;x><x>=x>>x>?x>@x>Ax>Bx>Cx>Dx>Ex>Fx>Gx>Hx> I"x> L"x> P"x> U"x> ["x> b"x> i"x> k"x> m"x> p"x> u"x> {"x> #x> #x> #x>##x>-#x>+7#x>9A#x>IK#x>[\#x>ud#x>l#x>t#x>|#x>#x>#x>#x>#x>##x>D#x>Z*$x>i6$x>H$x> _$x> q$x>$x>$x>C $x>J#$x>R&$x>,$x>4$x>: %x><%x>-B2%x>HF%x>LX%x>Qh%x>S{%x>W%x>_%x>b%x>e%x>j%x>o&x>u1&x>y@&x>&}'x>`'x>j'x>q!(x>x0(x>M(x>X(x>f(x>(x>(x>(x>(x>(x>')x>0)x>t)x>~)x> )x>)x>)x>)x>)x> *x> *x> #*x>* 3*x>C G*x>o *r +* +. G+ȷ3 V+ȷ6 l+ȷ<P v+ȷY[ +ȷd +ȷl 4,ȷz [,ȷ} e,ȷ q,PY ,P ,P ,P ,P ,P ,P -PL $-ࣸ /ࣸ  +0ࣸ? K0ࣸS z0ࣸl 0ࣸ 0ࣸ 0ࣸ E1ࣸ 3ࣸ% 3ࣸ+ 5ࣸ : 5ࣸ< 5ࣸ2C 6ࣸ;G  6ࣸEJ 7ࣸd 27ࣸi 7ࣸ q 9ࣸF :ࣸ :; ;;3 Y;;@ h;;D ;;T ;; #= 6> ? @' AL An B D NE F $ G0- HQ2 4H7 IH?9 Hi= HuD HP Hf HPi IP s &IP v 7IP0 x HIP _IP pIP IP I(* )J(*8! J(*! K(*! K(*" K(*#" \L(*0" L(*=" 1M(*z" [M(*" M(*"' W(*# fX(*# X(*$ X(*$ UY(*9$ Y(*S$ Y(*e$ Z(*n$ -Z(*$ eZ(*$ [(*1% \(*@% *\(*% B\(*% a\(*% s\(*% \(*M& ](*m& ](*t& a(*& (a(*& h(*U'I h(*Y'K h(*`'M ti(*j'Q i(*v'U i(*'W \k(*-(o k(*i(y k(*( l(*,* m(*M* Jm(*d* m(**  o(*+ 2oX ,oX >, oX k,BpX ,&OpX ,/rX $.[rX <.]rX /sX /tX /tX 00tX 0tX 0uX 0vX 1vX 1qvX I1}vX 1vX 1vX 1vX 1vX '2vH#N2vH#Y2 wH#2xH#3-HzH#p38czH#3>={H#3O|H#~4`}H#4v}H# 5|o~H#5~H#5H#5H#%6`6ڀ6 777ρ777+7D7S38^=8oG8Q88Ȃ8ڂ89 9929K9^9p:a3:!aL:&aV:)ab:-˃ap:2݃a:8;a:=Ta:Aa:Ka:SaM;l`w;z`;~1`;I`;^`;` <`+<`<`<߇`=C`=r`=` >`$>`H>`k>ӈ`>`>`>`?A`V?\`?+ p`@A`/@G`@V׋`@eb`@jˌ`@n`Awy`0A{`CAӎ`RA`_AW`Bh`3Bv`>B `B `EC$`C 8`CV`Ch`8D{`D`D8ؐ`DBODIYDLEPEPdEYE^E^E_<EjNEkFvϒFwFzF};;FP^Fm{FFF-G˔_GxGGGÕGוGGGB;H`OHwXHHHII  JJbGJxJ%J(ZJ.K .L[L,jL՛LLLLTMIMzMMM=M[MN#NbN ̠eN NN8NN.O ZrO+O2zjQ N{Q NQ,R6RPRЧ_RR$RHRqR=SS S SSԪSST$(6T+p^T1vT2>T8T<MTGgTIULۮUSUS;UYѯNU\gU`Z{UcUgǰUiUlUnGUqUsUv̱UwUx9VlxWVxVkxVȵxV xVvx+WxYW¶xeW޶xzWxW0xWxWxXx#XȷxxZicxZnxxZt xS\1 x\=@x][Nx]]f]_]e]g ^t6^{H^^*^O3_[@_gM_sZ_o___o` ~`%`B`g```Fa `a=zaQadaoa {a a a b(b-?b1b6c;?cZYbdnfex4eKff_g,h>?ChCmphLhQhXh\h`#>ifivii'jQ^jjj'kHkkk'.l\Ilal yl  !m mKmmm m"m$m+Ln2lCn? snLnS6oXTo_[oaUokkon pu*rIrjrr s!sNw9YFw ^YqwkY}w|YwYw гxгx г\zF&гz^7*zdL*zl~WzrW{W|W9|WU|FW| RW|!\W}$fW}'XT>}<XTC}=XTE}>XTG}?XTI}@XTK}AXTM}BXTO}CXT\}DXT}KXT}X-XT}g<XT}oGXT}wXXT}cXT}tXT~XT ~ XT;~ XTp~XT~XT~XTXTqXTXT !XT! 0XT6 dXT1rXT@XTJXTH\XT_XT`GXTMwXXTqeXTXT&XTXTXTmXT1XTńAXT݄aXTrXT6XTOXThXTXTυЅG*](.h).p:6{>9B:W;;<߇A FAHM$Ja^UufW^aaSmr}3ZDpQfy   +h5FQ[Kn'Վ4 =I MK T M\ F , (U ( (!(!(!(!(!(!(!(!(!(!(!( !( !(Ó !(Ǔ !(˓ !(Г!(ԓ!(ؓ!(ܓ!(!(!(!(!(!( !(!()!(A!(X#!(o&!(w(!({)!(*!(+!(-!(/!U (4!( 5!("6!($7!(&8!((9!(*:!(/;!(1!(7?!(9?!_ (NG!r (V! ([! (ʕ]! (ؕ_! (c! (&u! (<x! (N!! (!* (!4 (!> (]!H (n!(p!(r!(t!(v!(x!(z!(|!(~!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(!(×!(ŗ!(Ǘ!(ʗ!(̗!(Η!(З!(җ!(ԗ!(֗!(ؗ!(ڗ!(ݗ!(ߗ!(!(!(!(!(!(!(!(!Z (|!g (|!t (|! (|! (|! (|! (| ! (|! (|! (|! (|! (| ! (|$! (|(!- (|,!^ (|8!k (|:!w P! d" m" " " ǘ " Ԙ" " """ 4"="K"Κz")"6"A"R"']"7j"Gu"W"f"u"" p'"  p*" p7"' p8"6 pL"B pP"M pe"Z pn" p"Ü"͜"""""lM"}Q"T"q"+"7"Gϝ"`#k #x' #5#.#9#;#\R#mS#~U# U#%X#-Y#Xe#bf# em#:pN#TpN#apN#qpN#~pNş#pN#pN#pN#pN#pN%#TpN#^pN#lpN#vpN#pNӠ#pN#pN*#pNZ#,0]#E0#O0#\0#f0ˡ#0#0#0#0#0#-0#F0#_0$#w09#0m#0u#0#0#0#0#0##0 #10#C0-$P02$\0Y$i0 $v0 $0ţ$0ϣ$0ԣ$0$0$0$0 $0$0$(0$ $O0,"$o04$$0<&$0D'$0L)$0T+$b02$07$o!hd$!8 $!8#$!8*$!8%!8%!8%!8!!!! !!!"!#"$"%"&"'("(6")E"*S"+c",i"-o".u"/{"0"1"2"3"4"5"6"7"8"9":";";"<"=">">"?#@ #A#A#B$#C.#D8#EG#FX#Gg#Gt#H#I#J#J#K#L#M#N$O$P$Q)$RS]TU=VSWMXyYZ[\4$]D$^O$_V$`_$ah$bq$cx$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r%s %t%u"%v)%w2%x;%yD%zN%{Z%|f%}r%~}%%%%%%%%%%%%%%%%%&&&&&&%&-&7&D&K&Q&X&d&p&|&&&&&&&&&&&&&&' '''&'0':'D'O'W']'c'l'q'|'''''''''''''( (((%(/(9(C(K(R(X(_(f(m(|(((((((((( ))-)=)M)])f) o)!{)")#)$)%)&)')()))*)+),)-).)/)0)1*2*3*4.*5<*6P*7c*8y*9*:*;*<*=*>*?*@*A*B*C +D+E+F*+G7+HA+IE+JL+KU+L^+Mg+Np+Ox+P}+Q+R+S+T+U+V+W+X+Y+Z+[+\+]+^+_+`+a+b,c,d,e,f$,g0,h<,iG,jT,ka,ln,mt,nx,o~,p,q,r,s,t,u,v,w,x,y,z,{,},~,,,,- ---"-'-6-E-N-Y-`-g-n-s-x----------------. ..$.-.9.F.V.^9k f.y....I....../!/4/H/Y/h/|////////0-0C0Q0_0y000000001$191N1c1y1111111111222-2C2^2|22222223 3 %3 63 G3 X3h3z333333344)4=4D4W4i4}444 4!4"4#4$4%4&5'&5(>5,R5-"."/"0"1[52d53g54u55|565758595:5;5<5=5>5?5@5A5B5C5D6H 6I6J,6K>6LP6M[6Nn6O6P6Q6R6S6T6U6V6W6X6Y6Z6[6\7]7^7_*7`77aD7bQ7c]7di7eq7fx7g7hpi7j7k7l7n7o7p7q7r7s8t8u8v'8w:8xD8yJ8z_8{j8|p8}8~87<v888888888999#9/979D9N9Y9e9s99999999999999:$:2:@:N:\:b:e:p:}::pO......b..............i.. . . . . . . ............... !.".=:>:AC)D.E.F.KZL.M.N.O.WG+XY.[.hi.j.k.rs.t.u.z.{.}!~...::(.q............................................ ....................e..............=...... ............ .!."#.$.%.%.&.'.(.*B+.,.-...0.1.4.5.6.7.9.:.;.<.=.>.?.@.D*E.F.G.JoK.L.M.N.O.P.V.W.X.Y.Z.[:]^.`.b.c.d.e.f.h.n\o.p.q.s.y:z:{:|;};~&;6;F;V;f;g..{.v;;;;;;;;;;;; <<#<...0<B<U<h<{<<<<<<<...M(<="=/=<=I=V=c=p=}=========== >>&>3>@>M>Z>g>t>>>>>>>>>...&6'.78.^_.dee...<.89.HI.X[Y.hi.xYy..!..!.%"&.,3"-./~"0.8>9>;><>=?>???@?A&?B.?C6?D>?EF?FN?GV?H"I.J.K"L.M.N.O"P.Q.R.S.T"U.V.W.X.Y.Z"[.\.].^._.`.a"b.c.d.e.f.g.h.i.k.l.m.n.o.p.q.r.s.t"u.v.w.x.y.z"{.|.}.~...#....... #........#.##..-#...7#....A#.....K#......\#...d#....l#.....t#......|#.......#....#...##.#.#.*$......H$......_$ . . . q$ ....$.....$..... .!."$#.$.%$&.'.(.).*.+$,.-...3$4.5.6.7.8.9 %:.;%<.=.>.?.@.A2%B.C.D.E.F.GF%H.I.J.KX%O.Ph%Q.S.T.W.^%_.`.a%b.c.d%e.f.g.h.j.k.l.m.n&o.p.q.t1&u.v.w.x@&y.z.{.|'}.'.'.!(.0(.....X(..f(....(..(..(..........)....................)..)...).)... . * . . . * . . . . #* 3* . . . . G* . . . ^? h? * +) +* .. .5 l+6 .7 .7 .8 .9 .: .; .< .= .> .? .O v+P .P .Q .R .S .T .T .U .V .[ .\ .\ .] .^ ._ .g .k 4,l .m .m .n .o .p .p .q .r .s .y [,z .| e,} .~ . .   q, . . , . . . . . , . . , . , , , . - . .  $- . . / +0 K0 . . z0 . 0 . 0 . 0 . E1 3 .$ 3* 59 5: .; 5< .= .> .B 6C .F 6G .H .I 7J .K .c 27d .e .h 7i .p 9 :  4  r? : . . Y; h; . ; . . . . . . . O  H #= 6> ? @ A A B D NE F# G, H- .. ./ .1 4H6 IH< H= .> .? .@ .C HG .G .H .I .J .J .K .L .O HP .P .Q .R .c Gd HIe Hf .g .h Ii .j .r &Is .u 7Iv .x .x .y .z .{ .{ .| .} .~ .~ . . . . . . . . . _I pI I . K K 1M [M M v x Hz ={ }   ڂ    $  A , @ k ¶  N W ׋  v   Z N z < a + x ? `  C  s !   v ? ? R eZ . )J . . .  J . . . K \L L . . . .& W' . fX X . . X . UY Y . Y . . Z -Z . . . . [ . \ . *\ . B\ s\ .  \ ] ] a hH hJ hL tiP iT iU .V \kW .n ko .p .q .x ky .   v f  l . m . Jm m . . . . o . . `  g  2o .o.. o .Bp..%Op&.'.(..r/.0.Zr\r].^.^._.`.a....tttuvqvv...}vv..v..czv. w . . ....-...8.9.:.;.>.?.@.N|O.P.Q.`.a.b.c.d.e.f.u}v.v.w.x.y.{o~|.}.~..~r....ڀ.... .......ρו˔K2+D.S...^..o.........Ȃ. ....^p... !.".%&.'.().*.+.,˃-.../.0.1݃2.3.4.5.6.7;8.<T=.@A.JK.RS.T.U.V.W.bcdepfgؐhiQj[kl.m.n.yz.z.{.|.}1~.....I^.....߇................ӈ............ . . ....\.+.+.,.-...../.0.1.1.2.3.7.G.H.H.I.J.K.L.dbiˌmvyz~ӎ.h........... .$......8...........V.h.{.=>?@YAB.C.D.KOP.Q.R.S.T.U.`faxbZc8def#gh i k.uϒy|;Pm.......-...Õ...B.`..w...... ..b...$(.../.0.1.2. ..,..՛.T..=[ ̠....*+.2.3..................?????.....Ч...Hq...  .Ԫ..#($.%.*p+.,.01>7;M<.=.HKۮL.QARS.Xѯ[\._Zbc.fǰhi.kmGn.ps.u̱w.yz{޶|շ}~ȷAl..ȵ. ...v......0............... )#:mLM.N.TǼU.V.XڼZ \>].hcmxn.r.t.u.v.w.0 1.[.\.^_.cdg.h.i.p?qr*sz{.|.}...O........[gs.......X.... %Bg... =Qd ',?05:?;.<.=.>.?.YYZ.mfn.o.p.x.......o!@@#@4@?...>.?.BmC.D.E.KL.PQ.R.S.T.U.WX.Y.[\.].`.a.b.c.ef.g.h.i.j.uv.w........Q......................'\.... . .   K. .!.#$.$.%.&.*L+.+.,.-.1l2.3.4.5.>?.@.@.A.B.C.D.E.E.F.G.KL.L.M.N.O.P.RS.T.U.WX.X.Y.Z.[.\.^_.`Ua.b.jkk.mn.o.p.u.v.w..j....N...b.."#.(d)../.45.<=.>.?.@.A.B.C.D.E.F.G.H.I.J.Obl}~..."-................|....E@F ........................E&F.G.H.I.J.K.L.M.N.O.O.P.Q.R.S.]7^._.`.a.cLi<jk~qr.r.s.t.~..............F.....a \!.".#.$N@%&Y@<f@=q@>|@?@@@A@BCD.D.E.F.G.G.H.I.JK.K.L.M.[.[.\.].^.j.j.k.l.m.nGo.p.p.q.r.z.z.{.|.}@~@ct.................................................. ! 0 d ../0r4.4.5.6.7.?@.@.A.B.C.IJ.K.K.L.M.N.w.~e@@@@@@ AA..........1Ar.........)A*.../.0.1.2.3.4_ 9;@A.B.GMJ.K.TuV_H ` j3AkCAlr.s.t.|3}.~..Q.f.> ..5.FSA..............'4 .K .L .T .U .W .Y .\ .] .^ ._ .` .a .b .c .d .  [A!hA!uA!A!A!A!A!A!A !A !A !A !A !B!B!B!(B!!!5B!BB!OB!\B&!jB(!yB)!B*!B,!B-! .!U /!.3!B4!B5!B6!B7!B8!B9!C:!C;!!C!NC@!]CA!jCB!wCC!CD!CE!CF!r G!.V!.W!.Z! [!.\! ^! c!.d!.w! x!.y!.y!.z!.{!.~!! !.!.!.!* !.!.!C!C!C!C!C!C!C!D!D!#D!1D!>D!KD!XD!eD!rD!D!D!D!D!D!D!D!D!D!D!E!E!E!+E!9E!GE!UE!bE!oE!|E!E!E!E!E!E!E!E!E!E!E! F!F!%F!4F!CF!RF!aF!pF!F!F!^ ! ! !w ! " " ".". "  "." " "."!"%".%".&".'".(".)".)".*".+".,".,".-"..".3"4".5".<"=".>".?".?".@".A".B".B".C".D".r"s"t"u"'v"7w"Gx"Wy"z"."f"u""" "'"6"B"M"Z"F""""""l"+"G".".".".".".".#k#.#. # #.##.#.#.#.#.8#R#~X#f#g#h#i#~j#qk#l#:m#.n#.n#.o#.p#.q#.q#.r#.s#.~#T#a####^#l#v#.#.#\####.###.#.####1#\#v$.$i$. $. $. $.$*$b7$.$!$.$.$.$.$!$.$!$.$.$.$.$.$.$.$.$.%!%!%.%.%.%.D$O$V$_$h$q$x$$$$$ $ $ $ $ $ $ $$$$% %%"%)%2%;%D%N%Z%f%r%}%%%%%%% %!%!%"%#%$%$%%%&%'%'&(&)&*&+&,&-%&.-&/7&0D&1K&2Q&3X&4d&5p&6|&7&8&9&:&;&<&=&>&>&?&@&A&B&C'D 'E'F'F&'G0'H:'ID'JO'KW'L]'Mc'Nl'Oq'P|'Q'R'S'T'U'V'W'X'Y'Z'['\'](^ (_(`(`%(a/(b9(cC(dK(eR(fX(g_(hf(i)j)k)l)m)n)o)p)q)r)s)t*u*v*w.*x<*yP*zc*{y*|*}*~******** +++*+7+A+E+L+U+^+g+p+x+}++++++++++++++++++,,,,$,0,<,G,T,a,n,t,x,~,,,,,,,,,f.y.3%363G3X3h3z333333344)4=4D4W4i4}4444444445&5>5R5[5d5g5u5|555555555555556 66P6[6n66666666666666777*777D7i7q7777777888D8_8 j8 8 8 8 889?E@SA')NQ:RAS/-  !!"#$$%&''()*+,-./0123456789:;<=>>?@ABCDEFFGHIJKLMNOPQRSTUVWXYZ[\]^_``abcdefgh?@AABBCCDDEE@@@@@@A A0AFFGGHHIIJJ@AABBBB@APA`ApAAAAAAAAAAAAAAAABBijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@uAT@K?BJ DB=+? _`kcd    &D *++++klmnottyy{|}~  F/BC pUYDEGBwHI$&q"!B*+)JKL5CKOSMdmtzNt.O PQ RSC6h>?@?TUVWXYZ[@BhB\]^-aEbvefgihij"SlmnoDpdqrspBBzD@Ft1EZuvzwxyz{ "8Ndz P  @ p 0 ` P  @ p 0`|}~!#%'*-03JPVZ^b BfHBjnBrBvBz~BC CC C*C4C>CHC B4B\BB BBBBB!B%C)CC-%C1/C59C9CC=MCARCEWCI\CMaCQfCUkCYpC]uCa{L?>,<LXew #5Mc| #<Rhx(8HTas1I_x 8Ndt2H^t$:Pf|,BXn4J`vD&T_oz"-6AKVdp{$/:EPqz !',2;BHMTl)>Sh}   B $B (B ,B% 0B* / 8B4 LBC PBG TBK XBO S `BW dB[ a tBe xBj |Bo t y B~ B B BB B B B B B B BB B B B B B B B BB!B !B!B!(!1!B:!BC!BL!U!^!Bg!Bp!By!!B!B!B!B!!!!!!!" ""1"D"S"`"j"{""##U####### $$0FaE$ $x%%%%%%%%N&Z&f&r&&&&&&&&&&'%'0'N'g'''''''((A(x((((()")%)))/)6)>)G)Q)\)h)u)))pEyD?*EV*2p#+6+d+h+:+++++++,(,?,C,   -- /->-T-i-------- .!.:.X.m.......////C/Y/r/ ///// 060:0\0u0000 11)171Q1c1f1{11111112202H2\2u2222222333-3>3M3_3q3333333444[4{44445595]5555556$6.686A6L6U6a6p6{66666666666667)7/7A7X7z7777778.8H8a8z888888929N9h999999DBlB9 !':@:V: #>]:>n:}:(?:= W?::::::"!;F;#$%,4&;;;<<<`<y<<<<<<= ='1=P=o===== >)>(D>c>>>>>>)+?J?i?????*@3@R@q@@@@@+A9AWAuAAAA,AB>B^B~BBBB- C,CLClCCCCC.D>D`DDDDD E,E/^EEEEEF6FZF~FF0FFGAGeGGGG1H2 H*H3?HXHtH5C46C7=<89HI:;BL>ff@=>?DEHIJ-B(pRW]q#%5IVviLnpTAIIIIJB>JPJsJwJJJJJJJDTDCDCJ"K)KjKrKKĤKFL7L>LOLGpLLLLLLLMM)M??GMRMqM}MMMMMMMKMMMNTNeNNNNNNO0OMOjOOOOOOP P:PXPnPPPPPPQQ8QRQoQQQQQ R#RPR}RRRRRRS7SSSqSSSSSST2TMTjTTTTTTU-UJUgUUUUU$VeVwVVVVVVW"W?W[WvWWWWW ף<LX4XLXMXXXNXOXY8YGYPhYYYYYQRSNZSZUuZZZZZZZ[[5[E[b[s[[[[[[[[VW #<\XY]\Z[$tI\\\\];]]]]]]]^^"^D^g^^^^^_C_e_____`5`b`````_`6a]aaaaa bGbnbbbb c1cXcccccdBdidddde,eSezeeeef=fdffffg'gOgvggggh9h`hhahbhc i1iWidiiiefii j j1jDjcjzjjjjjjjjkkk!k/k=kKkgpkkkkhNiKCLCQCk!CkBl7lBB CC3CBBDlBB[l6ColBljlllk,ml`mfmrmmmmmmn n1nGnYnenhnynnnnnnnnnot>!nAAB oosLsZsdsns}sssssswsxt*t;tMt_tottytz{tt|(uButuuuv~}AC+v:vIvXvAA`BgvAvw)wMwqwwwwwwwww x)xMxrxxxxxxxxyy@ycyyyyyz]z_zxzzzzzz{S{a{q{{{{{{{ |C|u|||||| }+}R}i}}}}}}~~~*~6~B~N~Z~\~^~j~~~~~6\~+C,C-C.C0C2C0$3BQt̀=Yw!j˄ЄӄքلLM  L333?Av{'9K\ˆ@]*5R`*ĉ؉%R{Š/Y;u݌>bݍ.U CCCCCCCCCC8CCC̏׏BB`BzC>dÑ (r   nI_k{}&Gag͓ޓ@XkՔ=b$.0N]ǖʖז!<Pkޗ?PfyApA@A\BAA˘0UB{ ԙ7Hqx њ>ZxǛ&A[}Μ %4gѝ<fӞ$Mp˟*Ng5!Vq"͡CABBBBCCC$huТ DXf&'ã<Upڤ+Eazѥ%:OdyѦ)Bd*+.7/_01Ψڨ 0Op2346l5670Rt89>O\:;׬<Wew=Э %06=K?}@Ʈͮծ3A,{CDE)AFlGHڰIJ6KfvMYVX_\^O0Nh̲9YuʳP0TVQyδ*NS|T۵U"G`Z[Gs`?fjoabܸ?c $?edϹef5KnȺ7^Ȼ .Hgxhijk#l,@[mA4D A۽%`Dk`D95`DF`D`D Y`DpA`DBl`DB`D%C DkÏ D9*à D*ñ D*þ D ־ DpA* DB* DB* D%CD.DkADPD`DBpDzDBDWCD9DDD Þ?@DpADBDBDDBzDk@¸D9@ɿD@ڿD@D @DpA@o&;bu{DCJCYC[CSCXC]C^C_CcCNCOCPCTCUCVC`C!dC4eCvCwCxCyCspxyvBB`Bwz??>{|}~4V~&7I^(7Xgw (/8MQf !5F[p*>Wm'On -Ll9];_)Ij/Rr)Sx %A\v;\} (DTDh6`f \(g}3C} Gw'8IZk|~WMf@8>Jq5c'^lz"1>_$0:G +CUcms!`!` 6Lbx(>T~0F\r*@Vt!7Mcy "8aw-d @w4KL=wu=)\= ף=Q=/F]t6Ms(Mr,W{I BU#5]q DDHD#3!W$qn(;Oap~;EzDDBtC PG #= #= )\> ף=C fff? =CCC @$5^bfjXsuws= >Q>> O"%&(%04EVjz ,=N]l~ .@Rdw"0CRapIly EFR*,.B12$4_678I;^p<=>?@CDEFGH JKjxOP"5[cx-9DSZoz  !5Mh (.>OWbw! 4 G S ^ v           % D P V b k      p  $ @ TBYZ[\]_`acBdeghiC Ck Clmmro;Dtvxyz{B|}~pAk AAA   HHÓAD@<   %AYspBpBA"4FYgyh|     %5GUPCG???A+059<@J "#$%+,-*).& AAAA'(/0 )<O4512367BHCC89<4B:;<=l>?@ABCDFGEzDHIJKLMNOQSPRUVWXYZ[\]^<_\`abcd';Oen+7CO\iv!0?N]l{ /<IVcp}(5BO\iv  % 2 ? L Y f s           !!$!3!B!Q!`!ghjkl